Clone RE21254 Report

Search the DGRC for RE21254

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:212
Well:54
Vector:pFlc-1
Associated Gene/TranscriptCG31179-RA
Protein status:RE21254.pep: Imported from assembly
Sequenced Size:1292

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31179-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE21254.complete Sequence

1292 bp assembled on 2009-09-15

GenBank Submission: BT099754.1

> RE21254.complete
TCTGCTTATCGCAATCGCCGCCTGCCAAATGCCAGGCGATAGCGCGTAGA
ACTCTTGGCGCTAATAAAGATCTCAGTAGTAAGCGGTGTGAGGTGGTGAG
GGGTGACATTAGGCGGTGGTGCAGGGCAGCCCTCCTGGCCAAATCCGCTG
CTTTGTGAACTCAAGCTGACAGAACGCTATTTCCAATTGTGCTATTAATC
TGCCACATTTGCACTTCCGCGGAAAAGAGTCGGCGGGCGGATGTGATCTC
TTTCGCTCGTCAGTTGGCTGACTCGCTCTGCAGGGGTGATTTGCGGGCGA
GCGAGTGAGACAGAGCGAGGCAGAGTGGTAACGCTTGGCTAACCTGAAAA
TAGAAACAATCGAAATAAAAATACATTCTCTTCATGCTCTCGTCTAATAA
AAAACCCCAAAAGCAAAACGTTTTCCATTTAAAATGTCGTCGCAACTGCC
AGCGGGAAGTGGACGTCGAGAGTGGCAAGTGTGTGGGGCAAACTCCGGCC
AGCGGCCAATGGCGGTTGGCCGAGGCCACGCCCCGTGGCTCAATTACCGA
CCAGTGCTGCCCATCGGCGGGCAGAGCGAAACCTGTTTCCACGAGCGAGA
GGCAGTCAGGCGCATGTGCGATCAGAGCGGGATGGATGGCTCAAGGGTGG
ACCAACCAGAAGAGGCAGGTTGCTGGTATTATGGTAGGTTAGGTTCAAAC
AAGGTGGCAAACTGGCTCTTAACCGAAATAGGAAGGAAGTCGGCAGCGGC
GTCGACGTCGGGCAACTGGTTTGACTTGTTTCCGGCTCACTCCAACAGCC
CAAACCCACCAGCAATCGGCAGAGGCAGCCAAGTCGGCAGAGGGCAGGCA
GAGCAGCGGCCGTCGGCACAATTTGATTGCATTTATGAAAAGCGTTTTCG
CCCGCTAGCACGCGTCCGCTCCCAGCTCGCAATTCGCCATCCGTAATCCG
TAAACTTTAATCCGTAGACCGTAATCCGTGAATCCAAAGCAGTTCTCAGT
TGGAATTTCCCGCAACGGGTAGTGCTTAAGCGCGGAAACTGAATTGAAAT
CAATCGGACGATTAGTGTGTGCTTCGCGGTTGAAACACTCTACATCTAAC
TATTAAGAGAAAAGAGTGCCCAATAAGATTCGAAAAGTGCAGTGAGCGAG
CTCCAAATTGGCGCCACTAATTGCCAAAATGTCCAGCCACGAGGAGGATG
ACCATGAGCACGAGAACGAGCACGGCGAAGAGGTGGAGGAACAGGAGATC
CACGTGGATGTGGACTCGGACTCGCGGATGTCATGTGGCAGC

RE21254.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
C15.d 3199 C15.d 434..1725 1..1292 6460 100 Plus
C15.c 2354 C15.c 1..880 413..1292 4400 100 Plus
C15.f 1599 C15.f 1..611 682..1292 3055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17322849..17324140 1..1292 6430 99.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
C15-RA 1020 CG7937-PA 1..114 1179..1292 570 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:25 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
C15-RA 1856 CG7937-RA 1..386 907..1292 1930 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-27 15:02:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21499080..21500371 1..1292 6460 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21239911..21241202 1..1292 6460 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:02:50 has no hits.

RE21254.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:22:29 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17322849..17324140 1..1292 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:22 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
CG31179-RA 1..513 434..946 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:21 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
C15-RA 1..114 1179..1292 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:49 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
C15-RA 1..114 1179..1292 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:22:29 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
C15-RA 1..114 1179..1292 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 13:50:26 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
CG31179-RA 1..1011 1..1011 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:21 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
C15-RA 1..117 1176..1292 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:49 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
C15-RA 1..386 907..1292 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:22:29 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
C15-RA 1..386 907..1292 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:22:29 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21499080..21500371 1..1292 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:49 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17324802..17326093 1..1292 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:18 Download gff for RE21254.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21239911..21241202 1..1292 100   Plus

RE21254.hyp Sequence

Translation from 433 to 945

> RE21254.hyp
MSSQLPAGSGRREWQVCGANSGQRPMAVGRGHAPWLNYRPVLPIGGQSET
CFHEREAVRRMCDQSGMDGSRVDQPEEAGCWYYGRLGSNKVANWLLTEIG
RKSAAASTSGNWFDLFPAHSNSPNPPAIGRGSQVGRGQAEQRPSAQFDCI
YEKRFRPLARVRSQLAIRHP*
Sequence RE21254.hyp has no blast hits.

RE21254.pep Sequence

Translation from 433 to 945

> RE21254.pep
MSSQLPAGSGRREWQVCGANSGQRPMAVGRGHAPWLNYRPVLPIGGQSET
CFHEREAVRRMCDQSGMDGSRVDQPEEAGCWYYGRLGSNKVANWLLTEIG
RKSAAASTSGNWFDLFPAHSNSPNPPAIGRGSQVGRGQAEQRPSAQFDCI
YEKRFRPLARVRSQLAIRHP*

RE21254.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24653-PA 173 GG24653-PA 1..166 1..170 765 87.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10428-PA 170 GM10428-PA 1..170 1..170 870 96.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19429-PA 170 GD19429-PA 1..170 1..170 869 96.5 Plus