Clone RE21427 Report

Search the DGRC for RE21427

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:214
Well:27
Vector:pFlc-1
Associated Gene/TranscriptCG32195-RA
Protein status:RE21427.pep: gold
Sequenced Size:4663

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32195-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE21427.complete Sequence

4663 bp assembled on 2009-09-02

GenBank Submission: BT099685.1

> RE21427.complete
GGGCGGTTGGCGAGGTCTCATCTGAAAAGTCGTATAACTATGGAGCGGGA
AATTTACAGTGCGGAATACTTCGAGAGAGCTTTGGCGAGAGCTTATGGTT
GTGAAATGCTTCGCGTTGAGAACTTTCACATCAAGGCGGTGAGCCAGAAG
GGCGAGAACTTTTGCAGCGTCATCTACCGGGTGGCGTTGGTCTTTCGCAG
GTCACCCGATGGCGCTCTCGAATCAGGAAAATATATTCTCAAGGATCTGC
TGCCCGCCGCCGCTGCACTGGGCACCAACGAAAAGGATATGTTCGAGGTA
CTCCTGCCTGCCATGCAAGCCATTCTTGAAGAAGCTCCAAAGGAGATTGG
CGAACACAAGCTGAGCGCAGATTGCTTGCTAGTCGAGATATCTGCTGGAA
AAGAGCTCTACATTCTGGAGGATCTGGGCGCCCTAGGATACGAATCCTTT
GATCGTCGTCAAGGCTTAAATCTGGAAGAAGCCAAAATTTGCGTAAGGAA
ACTGGCTCAGTTCCACGGTGCATCCAAGGTTTTGTACGAGAAGAAACCCG
AATTGATTCAAAGGCTTTCGCCTTCTCACTATGCCAATGGATTGAACGAT
CGCTTCGCCCAGGCTCTCGTCTTGGAGGGCGCCGAATATGCCGCAGAAGC
GTTTGCCGAAGAACTTCCGGAAATATCAAAGAAAATGAAGGCTCAAATAC
CGAAAGCATATACGAAAAGAATGCGAGATGTCGTTGATCCAAACAAGTCA
TCATTGAATGCAGTTATTCATGGTGATCCCTGGTTAAATAACATTATGTT
TGATTTCGTTAATAAGAAGGCAACACTTGTGGATTTCCAAAACTGTTACT
GGGGTAGCCCGGCCATAGATCTCTACTTTCTATTTTACACCAGCCTCAAG
CCTGAATTATTGCTAAATAATCAAGATGAGCTTCTGAATTACTATTTCGA
CAATCTTCTGGAAACCCTGCGGCATTGCGGCTATAAAGACACACTGCCCA
CTTTTGGCCAGTTAAAGGATGAGATGAAACGGTGTTTGTTTTATGGATAT
TACACTGTAGTCTGTGAACTTCCCATATGTTGTGCTTCCCCTGAGGCAAG
TGTTGATTTCGGGGTTCACACCTTCGTAGATACGGATGCTATGTTAAAAA
AGCGACACCAATTATTCGCCAGCGAACGAGTGCGTCAAACCATAAAGGCC
ACTCTGCTTATGTTCGATCGTGAGGGTATATTAGAGACGCCCTAAAGAAG
GACCTTTTTGTTGTTTTATAAAGTGCTTAGTTTGTCTTGTCAGTATTTTC
TATGGAAGTCGGTTGTACGTACAAGTTCCTCCGATTTTTTAATATCAACA
GTGAAAGTGATCAATATTAACTTACAAATACTAATAGCTAAAAAAATGGA
TGTCTTACTTTATTCAGTTAAGAAGTGTACAGTTGTTTGTAAAAGATTTT
TGAATATAACTTATTTTTTCCTTCATTTGCACTTCTATATTATTGATTCA
TTAACCTCCGTCCCACTCCATTTACAACCAAATTTTTGTTAAAGGGAAGA
AACCCAACTCGAGTATTGCTCTTTATAAATAAATTTGTTGTCTGCCAAAG
TTTCTGGCCAAGATTTACGAGTGTGAGTGTGTGATGCATGTGCCTCGGCT
GGCTGCACTAAGAGCGATAAAGTTCTCCACCTCCTTGAAGCTAAATATGC
AAATCGCTTGCAGTTATTCTTAGAAAGTTGTCAGCTGCCAAGTGTAAGCC
AACTCGGCTCCAACTGAAGCCAAGCGAAGCGCATCGGGGAGCATATAGGA
CCAAAATCGAGGAGGAATATCGTGGTGGAGCGTGGTGGCCAAAGTGCATT
TGACGCCAATGTTACTTCGAACACACATGTCCTTCTTTCAAGTGTTTAAA
AAGCAATTTATTGCTATTGTTCGAAAGCAGTCAACTAAAGCCTTTATAAG
CTAGACTTTGAAAAGGGAAACCTTTGGAGGAATTTATTTATCGGAGCAAA
GTATTACAAGCACATACCTTTGTAAATTCTATATAATTGCTTGATAATAG
TTTTATTTTAAAAAGTGTTAAGCACAATTTTTATACCTATAATGCAATGC
ATTATCCTTTGAATTACACAAATCTTTTCAACTGTCGGTCAATTACCATT
TCCCCCCACTTTTTACCACTTTCGAGTCCCCATGGCTAAAATGTAAAGCT
TAATTAACATGGAAAACAAACACGAAGGCCCAATAGCAAACAGAAATCTG
TCTAAGGCTGCCAACCAGTCGAAAGAAACTCATAAATCAATTTTGAAATG
CATTAGAGACAGGTAACTTGCCGCCGCATCTCCCCATTCCCCGATTTAGT
CAAGGAAATGGCTTCGAGCAAGTGACTGCAGAATTTCAGCAACTCGAAGG
GGTCAACTTTCTGGAGCTGGTCAGTGGCCAAAAGTTACAGCAGAGTCAAC
CCCCAAGAACGAAATCCCAGCCCCCTTCGTCACCTATCAATTAATGTGTG
TTTCTCCAGTGTCATGGTAGAAGTAGAAAGAAGCTTCCTTTGCTTTCATC
TGGGGTTGCATTTACTTAACGCCTCGCCTCAGCACTTAACTTCCGTTTCC
TGTTACCCTGTGCAGGGGAAGGGGTTTTGATACGGAGTCTGCGACTTTCG
GGCAAGGCATTTGCAACTAATTGAAAGTGCAATGCGATGCTGCAGAATGC
AATTAATGCCTTGAGGCCCTGGGAGGCCAATCCACCCAACCACGGACGTC
TGCAGACGAGAAGTTGCATTCGAAACCGAAATGCACAGAAAAAACGATGT
GCAAATTAAGATTCTATGGGGGTGCTCAAAAATAACACAGGAAGTTCGAG
GAAGTGAGTGCGGTATTGATTTTTGAACGAATCTTGTGTATAATAACTAG
AGCCTTAGAAACCCTAACTTAAACAAAACTTTACGGTTCTTTAATCTTCG
AACCCTTGACACCCTCTACACATCTCCTTTTATTGTAGTCCCGCACCATT
TCCTATCTGAATAACTCAAGAAACTTTTATCAATTAGCTGCCAAATACTC
AGCGTAAGGCTCATGTTTGCGAAATTACGATTTAAGTCCGATTCCTGTGG
GGCAAACAATTAAAAGCAATAAATTTGCACAGGCAACCATAAATCAAAGT
CCGATCATAATCTCAGCCCAAGCAAACAGAGAGAAAAACCCAAAAACGAA
GCTCTCGCTTCCGCCCGAATTTTCCCCGCCTTTTCCAAAAAGTTCCAATC
CAAGGAAGTTCACCGCAATCCGGGGAAATAGTCGCTTCGCTTCGTTTATT
AATTGTACAACTGTCTCCAATCATAATTAATGAACTTTGGCACATCCTCC
GCCGCAAACTCCACATATCCCTTATTTCATGGGGAGTGGAAAACCAACAC
TGAAGTATAAACACAAATGTTTTCCTTGGCACACCATAAATCTTCTATTT
GGCAAATCTCTGTTGGACCTTTCCGTTCACAATTCGTGTTGCTCGCTCAA
CTATTACTTTTTTTGTTTTACTCGGCAGTTGGCAGTATCAATTAGACACA
TTAAAGGATCTGCTGGATTAGGCTTTTATTGACACAGAAAATATTTTGTT
TGAACTTAAACAAATGAGAATCTGTATAATCGAATTTTTAAAAGTAGCTT
ATGTGCAATACATGTTTTTATAATTTAAATAAATACATTTCTTGCTCTCC
CAAATGGCGAAGAGTGCTCCACCTGCATATTGAGATTACATGACTTGGTA
GTTTAAGTCCTAGAATTGTACATATGCAAATCCCTTATAATTAACAGCTG
GAATCTTTTGAAGACCACATACCCTATTTGCGACCAAAAAACCTAAAAGC
AAACATTTAAATTGCTATAATTTTTCATTTAGCTGGGGCTTTTCTTCCAA
CGATGTCTGCGAGATTGCGATTAGTCAGTTAGTCATTTCGGAGCCAAATT
TAAATAATTTCAAAGTGATGACAAAAGCTTTTCCAGCTATCCGAGTAATT
ATGTGCCCACATGGCATGCAGAGAAGGTTATGTGGAGACTCTACGCATTA
ACACTTTCACGGCAAAACTGTCTAAAGATAAATGAAAGCATCATTAGTCA
TTGGCCAACCCCACAAACCCTGTAATCACATGTGTCCTCCACAATTTTTC
ACATTCCATGCCAGAAGGGGTGGGATTATGTGTGATTAAATCCTTCAGAT
ACCCAAGTATTCATATGTAAATTCTTTGTGGCAGGATGTGACAGGTCCTG
TTTCTAGTCTTGCAACTAAGTACTTTGAGTCTTTTTGGTCCATTGTGTGT
GGCAAATTATTTATTGGCCATCATTACTTTGATTGCCTGAGGCTTTTCGA
AATTTTGAAGCAACACTTTTGAAATGGAATTTCTGCTCGGAATTGAAAAT
TCCGTCGGCCTTGCATGTGTATAATTTTAAACCATTTTCGGCAAACCGTA
TAACCAGAATTGCTTAGCTAATTCATAAAAATATGTTACAATTAAGTTAA
ATAGGTGCCACTGTATTTGACACGTAAAAGTCTTCCGTTTCATTATACGA
TATGATATGACTGTAAAAAGCTATTTGTCAAAACTCTTCTTTACGACGTT
TTTGGTGTATAAATAAAGAAATCCTGCGCTATTTTAAAAAAAAAAAGAAA
AAAAAAAAAAAAA

RE21427.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-RA 1690 CG32195-RA 234..1690 4..1460 7285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18105030..18108839 829..4643 18330 99 Plus
chr3L 24539361 chr3L 18104509..18104968 372..831 2270 99.6 Plus
chr3L 24539361 chr3L 18104076..18104443 4..371 1780 98.9 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-RC 1206 CG32195-PC 1..1206 40..1245 6030 100 Plus
CG32195-RB 1206 CG32195-PB 1..1206 40..1245 6030 100 Plus
CG32195-RA 1206 CG32195-PA 1..1206 40..1245 6030 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-RA 4876 CG32195-RA 245..4876 4..4635 23145 100 Plus
CG32195-RC 1563 CG32195-RC 107..1563 4..1460 7285 100 Plus
CG32195-RB 1701 CG32195-RB 245..1701 4..1460 7285 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-PC 401 CG32195-PC 1..401 40..1242 1936 100 Plus
CG32195-PB 401 CG32195-PB 1..401 40..1242 1936 100 Plus
CG32195-PA 401 CG32195-PA 1..401 40..1242 1936 100 Plus
CG10513-PB 422 CG10513-PB 23..419 67..1236 405 30.1 Plus
CG11892-PA 439 CG11892-PA 35..436 49..1236 363 26.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18115344..18119158 829..4643 19030 99.9 Plus
3L 28110227 3L 18114823..18115282 372..831 2300 100 Plus
3L 28110227 3L 18114390..18114757 4..371 1840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:36:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18108444..18112258 829..4643 19030 99.9 Plus
3L 28103327 3L 18107923..18108382 372..831 2300 100 Plus
3L 28103327 3L 18107490..18107857 4..371 1840 100 Plus
Blast to na_te.dros performed on 2014-11-27 03:11:32 has no hits.

RE21427.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:07:57 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18105030..18108831 829..4635 98   Plus
chr3L 18104509..18104965 372..828 99 -> Plus
chr3L 18104073..18104443 1..371 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:15:15 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 1..1206 40..1245 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:11:25 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 1..1206 40..1245 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:04 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 1..1206 40..1245 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:07:57 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 1..1206 40..1245 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-02 10:14:11 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 231..1475 1..1245 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:11:25 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 240..4874 1..4635 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:04 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 242..4876 1..4635 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:07:57 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
CG32195-RA 242..4876 1..4635 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:07:57 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18115344..18119150 829..4635 99   Plus
3L 18114823..18115279 372..828 100 -> Plus
3L 18114387..18114757 1..371 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:04 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18108444..18112250 829..4635 99   Plus
arm_3L 18107923..18108379 372..828 100 -> Plus
arm_3L 18107487..18107857 1..371 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:02:39 Download gff for RE21427.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18108444..18112250 829..4635 99   Plus
3L 18107923..18108379 372..828 100 -> Plus
3L 18107487..18107857 1..371 99 -> Plus

RE21427.pep Sequence

Translation from 0 to 1244

> RE21427.pep
GRLARSHLKSRITMEREIYSAEYFERALARAYGCEMLRVENFHIKAVSQK
GENFCSVIYRVALVFRRSPDGALESGKYILKDLLPAAAALGTNEKDMFEV
LLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLGALGYESF
DRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLND
RFAQALVLEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMRDVVDPNKS
SLNAVIHGDPWLNNIMFDFVNKKATLVDFQNCYWGSPAIDLYFLFYTSLK
PELLLNNQDELLNYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGY
YTVVCELPICCASPEASVDFGVHTFVDTDAMLKKRHQLFASERVRQTIKA
TLLMFDREGILETP*

RE21427.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23615-PA 402 GF23615-PA 1..402 14..414 1405 63.7 Plus
Dana\GF15176-PA 399 GF15176-PA 1..399 14..414 1296 58.9 Plus
Dana\GF17430-PA 423 GF17430-PA 38..420 37..412 439 30.8 Plus
Dana\GF15396-PA 417 GF15396-PA 21..416 23..411 402 28.2 Plus
Dana\GF17563-PA 437 GF17563-PA 39..434 23..412 376 26.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13650-PA 401 GG13650-PA 1..401 14..414 1933 88 Plus
Dere\GG11391-PA 439 GG11391-PA 35..436 17..412 399 29.5 Plus
Dere\GG12269-PA 417 GG12269-PA 40..414 23..412 398 28.3 Plus
Dere\GG23632-PA 417 GG23632-PA 21..416 23..411 369 27.4 Plus
Dere\GG10081-PA 407 GG10081-PA 16..405 30..412 362 28.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14448-PA 416 GH14448-PA 20..412 21..411 1199 54.7 Plus
Dgri\GH14835-PA 412 GH14835-PA 22..409 20..412 379 28.8 Plus
Dgri\GH17368-PA 435 GH17368-PA 35..432 20..412 363 28.2 Plus
Dgri\GH10995-PA 424 GH10995-PA 24..423 23..412 347 26.4 Plus
Dgri\GH17854-PA 417 GH17854-PA 46..416 51..412 340 25.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-PC 401 CG32195-PC 1..401 14..414 2084 100 Plus
CG32195-PB 401 CG32195-PB 1..401 14..414 2084 100 Plus
CG32195-PA 401 CG32195-PA 1..401 14..414 2084 100 Plus
CG10513-PB 422 CG10513-PB 23..419 23..412 454 30.1 Plus
CG11892-PA 439 CG11892-PA 35..436 17..412 404 27.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13583-PA 413 GI13583-PA 18..411 19..412 1111 53.7 Plus
Dmoj\GI17510-PA 418 GI17510-PA 22..418 23..412 388 30.2 Plus
Dmoj\GI22569-PA 420 GI22569-PA 26..420 22..411 347 26.8 Plus
Dmoj\GI10995-PA 419 GI10995-PA 46..419 48..412 346 27.1 Plus
Dmoj\GI22570-PA 429 GI22570-PA 18..421 17..411 343 26.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22863-PA 186 GL22863-PA 1..186 229..414 675 64.5 Plus
Dper\GL21714-PA 439 GL21714-PA 18..436 1..412 423 28.6 Plus
Dper\GL22862-PA 126 GL22862-PA 9..126 19..136 408 65.3 Plus
Dper\GL26274-PA 418 GL26274-PA 24..418 22..412 403 28.5 Plus
Dper\GL22107-PA 426 GL22107-PA 27..424 23..413 400 28.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16750-PA 404 GA16750-PA 5..404 15..414 1390 62.7 Plus
Dpse\GA11263-PA 439 GA11263-PA 18..436 1..412 427 28.8 Plus
Dpse\GA21833-PA 418 GA21833-PA 24..418 22..412 404 28.8 Plus
Dpse\GA10364-PA 426 GA10364-PA 27..424 23..413 397 28.5 Plus
Dpse\GA10365-PA 415 GA10365-PA 6..411 17..413 373 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14965-PA 301 GM14965-PA 1..167 14..180 782 91 Plus
Dsec\GM14965-PA 301 GM14965-PA 161..301 274..414 729 92.2 Plus
Dsec\GM17735-PA 400 GM17735-PA 23..397 23..412 423 30.6 Plus
Dsec\GM17834-PA 439 GM17834-PA 35..436 17..412 394 28.5 Plus
Dsec\GM17950-PA 417 GM17950-PA 21..417 23..412 357 28.8 Plus
Dsec\GM17734-PA 413 GM17734-PA 6..409 17..413 356 27.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14745-PA 401 GD14745-PA 1..401 14..414 2034 94.3 Plus
Dsim\GD18217-PA 439 GD18217-PA 40..436 23..412 458 30.4 Plus
Dsim\GD19842-PA 408 GD19842-PA 8..406 20..412 393 27.4 Plus
Dsim\GD18216-PA 413 GD18216-PA 6..409 17..413 356 26.9 Plus
Dsim\GD22588-PA 383 GD22588-PA 21..383 23..412 353 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13921-PA 411 GJ13921-PA 18..408 21..411 1160 55.2 Plus
Dvir\GJ23247-PA 428 GJ23247-PA 26..426 20..413 400 28.8 Plus
Dvir\GJ15249-PA 422 GJ15249-PA 22..422 23..412 381 28.3 Plus
Dvir\GJ24002-PA 435 GJ24002-PA 32..432 17..412 358 27.2 Plus
Dvir\GJ19105-PA 425 GJ19105-PA 49..425 51..412 323 26.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11089-PA 389 GK11089-PA 10..388 19..398 1088 52.4 Plus
Dwil\GK14343-PA 424 GK14343-PA 24..422 23..413 443 29.2 Plus
Dwil\GK12928-PA 436 GK12928-PA 38..433 23..412 398 28.1 Plus
Dwil\GK14341-PA 415 GK14341-PA 6..411 17..413 372 28.3 Plus
Dwil\GK19796-PA 429 GK19796-PA 60..429 51..412 361 26.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19944-PA 401 GE19944-PA 1..401 14..414 1893 86.5 Plus
Dyak\GE19947-PA 401 GE19947-PA 1..401 14..414 1890 87.8 Plus
Dyak\GE10718-PA 439 GE10718-PA 40..436 23..412 426 28.8 Plus
Dyak\GE18894-PA 407 GE18894-PA 7..405 20..412 386 31.2 Plus
Dyak\GE18453-PA 417 GE18453-PA 21..417 23..412 365 28.4 Plus

RE21427.hyp Sequence

Translation from 0 to 1244

> RE21427.hyp
SRLARSHLKSRITMEREIYSAEYFERALARAYGCEMLRVENFHIKAVSQK
GENFCSVIYRVALVFRRSPDGALESGKYILKDLLPAAAALGTNEKDMFEV
LLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLGALGYESF
DRRQGLNLEEAKICVRKLAQFHGASKVLYEKKPELIQRLSPSHYANGLND
RFAQALVLEGAEYAAEAFAEELPEISKKMKAQIPKAYTKRMRDVVDPNKS
SLNAVIHGDPWLNNIMFDFVNKKATLVDFQNCYWGSPAIDLYFLFYTSLK
PELLLNNQDELLNYYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLFYGY
YTVVCELPICCASPEASVDFGVHTFVDTDAMLKKRHQLFASERVRQTIKA
TLLMFDREGILETP*

RE21427.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:43:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG32195-PC 401 CG32195-PC 1..401 14..414 2084 100 Plus
CG32195-PB 401 CG32195-PB 1..401 14..414 2084 100 Plus
CG32195-PA 401 CG32195-PA 1..401 14..414 2084 100 Plus
CG10513-PB 422 CG10513-PB 23..419 23..412 454 30.1 Plus
CG11892-PA 439 CG11892-PA 35..436 17..412 404 27.5 Plus