Clone RE21473 Report

Search the DGRC for RE21473

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:214
Well:73
Vector:pFlc-1
Associated Gene/Transcriptsdt-RD
Protein status:RE21473.pep: gold
Sequenced Size:3831

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15342 2002-01-01 Sim4 clustering to Release 2

Clone Sequence Records

RE21473.complete Sequence

3831 bp assembled on 2009-09-15

GenBank Submission: BT099747.1

> RE21473.complete
AGTTGTTTTTCTACGCGTTCTGCGATCGGCCGCAATTTTTTTTTGTTGAT
TTTTTCGACCAATTTTAACCGTTTGTTTTATTCTCTTCGCTGTTGTGCGG
GCCAAGTGCGTGACAAAGAACCGATAAGCGATTAGATAAGGCCATATGCA
TACGAAAGATTGTCGCCGCACCTCGTCGCGCCACGCAGACAAAGATCGAT
GAAAGTGCAGCTCGAAAATGGTCGTGTCCACTTTGCACATAACGCTGGAG
AACAACGGCAATGTTGCTGCGGGGCAGCCTGCTGCCGTTGCTGCTGCCAG
TGTCGTTGGGGCAGCAACATCGCCGACCAAGTTTGCCGTGCTGTCGGCGC
AGCAGCTGCAACTGCAACTGCAGCAGCAGCAGCAGCAGCAGAACGAAAAG
GAGAACCATATGAACAATAATAACAATAACAGCGACTATTGTGATATGAA
TGGCAATGGAGTTGGAATGGGAAACGGTGGTAGTGGTGGACCGGGATCTC
TGACCCCCCAATCCCCCGACCAATATGTCGGCTCACCTGTATCATCCGCT
GCCACGCCCCAGCGCACCGCCTCCGCCCTGCGTCGCGGCATTCAAATTCA
ACGATCCTCGACGCGTTTGCGACAACAACAGGAGCAACTGCGCCGACGAC
GCGAGGAGGAGGAGCGCATAGCGCAGCAAAATGAATTCCTGCGGAACAGT
CTTCGTGGCTCCAGGAAGCTGAAGGCGCTTCAGGATACGGCTACGCCCGG
TAAAGCGGTTGCCCAGCAGCAGCAGCAGGCAACGCTGGCCACCCAGGTGG
TTGGCGTGGAGAATGAGGCATATCTGCCCGACGAAGACCAGCCGCAGGCG
GAACAGATCGATGGCTATGGCGAACTGATAGCGGCCCTTACCCGCCTGCA
AAACCAGCTGAGCAAGAGCGGACTGAGCACGCTGGCGGGTCGCGTTTCGG
CCGCCCACAGTGTCCTGGCCAGCGCCAGTGTGGCCCATGTCCTGGCCGCT
CGCACCGCAGTACTGCAGCGACGACGTTCCCGCGTCTCTGGTCCACTGCA
TCACAGTTCCCTCGGATTGCAGAAGGACATTGTGGAGCTGCTAACGCAAT
CGAATACGGCGGCGGCCATCGAGCTGGGCAACCTGCTGACCAGCCATGAA
ATGGAGGGTCTGCTACTGGCCCACGATCGCATTGCCAATCACACGGATGG
CACGCCCTCGCCAACGCCCACGCCCACTCCGGCAATTGGAGCGGCGACGG
GATCGACACTCAGCAGTCCGGTGGCTGGACCCAAGAGAAATCTAGGTATG
GTGGTGCCACCGCCCGTGGTACCACCGCCACTGGCGCAACGCGGAGCAAT
GCCACTGCCTCGCGGGGAGTCGCCACCGCCGGTTCCCATGCCACCACTGG
CTACAATGCCCATGTCCATGCCCGTTAATCTGCCGATGAGTGCGTGCTTT
GGCACGCTAAACGATCAGAACGACAACATTCGTATCATCCAGATCGAGAA
GTCAACGGAGCCGCTGGGCGCCACAGTGCGCAACGAGGGTGAGGCGGTGG
TCATCGGTAGGATTGTGCGTGGTGGAGCGGCGGAGAAGTCGGGACTGTTG
CACGAAGGTGATGAGATACTGGAGGTCAACGGTCAGGAGTTGCGTGGCAA
GACGGTGAACGAAGTGTGCGCCCTGTTGGGCGCCATGCAAGGCACCCTGA
CCTTCCTGATCGTCCCAGCGGGTAGTCCACCGTCCGTCGGCGTGATGGGC
GGAACAACGGGCAGTCAACTGGCCGGGTTGGGTGGAGCACATCGTGACAC
CGCCGTGTTGCACGTACGGGCGCATTTCGACTACGATCCAGAGGACGATC
TGTATATACCCTGCCGGGAGCTGGGCATCAGCTTCCAGAAGGGCGATGTA
CTGCACGTGATTAGCCGCGAGGATCCCAACTGGTGGCAGGCGTATCGCGA
GGGCGAGGAGGACCAGACGCTGGCCGGTCTTATTCCTAGTCAGTCGTTCC
AGCATCAGCGCGAGACCATGAAGCTGGCCATTGCGGAGGAGGCGGGTCTG
GCGCGATCCCGCGGTAAGGACGGATCGGGCAGCAAAGGAGCCACGCTCCT
GTGTGCGCGCAAGGGTCGCAAAAAGAAGAAGAAGGCCAGCTCCGAGGCGG
GATATCCTTTATACGCCACCACGGCGCCGGATGAAACGGATCCGGAGGAG
ATACTCACCTACGAGGAGGTGGCCTTGTACTATCCCCGCGCTACCCACAA
GCGGCCCATCGTCCTCATCGGCCCGCCCAACATTGGAAGACATGAGTTGC
GCCAACGTCTGATGGCCGACTCGGAGCGTTTCTCCGCCGCAGTGCCACAC
ACATCACGAGCCCGCAGGGAGGGCGAAGTGCCCGGAGTGGACTACCACTT
CATCACGCGACAGGCCTTTGAGGCGGATATTTTGGCGCGCCGCTTTGTGG
AGCACGGTGAATATGAGAAGGCCTACTACGGCACATCACTGGAGGCCATA
CGCACGGTGGTGGCCAGCGGCAAGATCTGTGTGCTCAACCTGCATCCGCA
GAGCCTTAAGCTGCTGCGCGCCTCTGACCTCAAGCCGTACGTGGTGCTGG
TGGCGCCGCCCAGCTTGGACAAGCTGCGCCAAAAGAAGCTGCGCAACGGC
GAACCCTTCAAGGAGGAAGAGCTCAAAGACATCATTGCCACGGCCAGGGA
TATGGAGGCCCGTTGGGGTCACCTATTCGACATGATCATAATCAACAACG
ACACGGAGCGCGCCTACCACCAACTGCTGGCCGAGATCAACTCGCTGGAA
CGCGAGCCCCAATGGGTGCCCGCCCAGTGGGTGCACAACAATCGCGACGA
GTCATAATGGGTTCTAAAGCACCCGCAACCACCACACTACCATCTTCCCT
AGGATCCATCAACACCCAAGAAATGAATAGCAAACCCAAACTCTTTGTAA
ATACAATTTTCAATTGAGCCATGAAGCGGAGAGCAGGATCGATTCCAGTC
CAGTAGTTCGGTTTGCCTGCCGATGCGATTAATCCCAACCCCTCCAATAT
TATATATAAATATATATATATTTATACTATTCGTTGCATATGTGCATTTT
AGTCTTAGAGAGAGATCGAGTTTTAATTGTGTGTACTCCTGTTTTAAAAG
CATTCCAACCTCTTTATGTATGTTCACAAAATTTGTTGTTCGATTAATCG
ATTTCGGGAATGCCACAGAGGAAATGGTGATGCTGAAATCAGTGATTTCA
AAAACCATATTGCTTCTTGTGGCACTTCCGTTTTCCTCTTTTTTTTTACC
ACTACCACTAACTTATATACTGTAAAAGAATGTTTTTTTTTTTTTTGTAT
TTAAATTAAGCTTGGACACTTCCTTAATTTCAAAGGGCAAATTGAAATTG
TAAAATAACGAATCAGCAAAGGAAGGCCAGAATCGATATGATAGTACCCC
TAGTACCCAATAAAATGTGTAATAATACCCATAAGCGACTCCGAATGTTA
ACAGAGCCAGAACAATCCGTAGGCAGCTGTGCGAGGGGAGATCGATCCGT
CGGATATAGATTCATATTCATCTTCAGATTCAAATTCAAAAGCAGAATCA
GAAACATACAGAGAAACCGAATCAGAAGCGCAGATACAGATGCAGATGCA
AGTGTTGCAATTACGTAATCTATTTACTTTATAAAATATATACTATACGG
ATATACATACACATAAATTATAAATCGAAGCGTACTTAATACAATTAATT
TTTAACAAAACGAATGCAAGAGCAAAGTGAAAACTAAGAAATAAAACCGT
TCATAAGAGAGAAACAAAAAAAAAAAAAAAA

RE21473.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-RD 4935 sdt-RD 56..3877 1..3822 19095 99.9 Plus
sdt.g 4887 sdt.g 161..3829 154..3822 18330 99.9 Plus
sdt.f 4908 sdt.f 182..3850 154..3822 18330 99.9 Plus
sdt.g 4887 sdt.g 56..161 1..106 530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8127693..8128981 863..2151 6445 100 Plus
chrX 22417052 chrX 8130062..8131216 2661..3815 5775 100 Plus
chrX 22417052 chrX 8124249..8124727 154..632 2395 100 Plus
chrX 22417052 chrX 8127397..8127633 628..864 1185 100 Plus
chrX 22417052 chrX 8129043..8129240 2151..2348 990 100 Plus
chrX 22417052 chrX 8129818..8130001 2480..2663 920 100 Plus
chrX 22417052 chrX 8122435..8122588 1..154 770 100 Plus
chrX 22417052 chrX 8129622..8129754 2349..2481 650 99.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-RK 2640 CG32717-PK 1..2640 218..2857 13200 100 Plus
sdt-RD 2640 CG32717-PD 1..2640 218..2857 13200 100 Plus
sdt-RN 3879 CG32717-PN 1651..3879 629..2857 11145 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:34 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-RD 3838 CG32717-RD 1..3815 1..3815 19075 100 Plus
sdt-RK 3790 CG32717-RK 106..3767 154..3815 18310 100 Plus
sdt-RN 5650 CG32717-RN 2441..5627 629..3815 15935 100 Plus
sdt-RK 3790 CG32717-RK 1..106 1..106 530 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-PK 879 CG32717-PK 1..879 218..2854 3160 100 Plus
sdt-PD 879 CG32717-PD 1..879 218..2854 3160 100 Plus
sdt-PN 1292 CG32717-PN 568..1292 680..2854 2998 100 Plus
sdt-PM 1901 CG32717-PM 1177..1901 680..2854 2998 100 Plus
sdt-PI 1269 CG32717-PI 545..1269 680..2854 2998 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8235881..8237169 863..2151 6445 100 Plus
X 23542271 X 8238250..8239411 2661..3822 5795 99.9 Plus
X 23542271 X 8232429..8232907 154..632 2395 100 Plus
X 23542271 X 8235585..8235821 628..864 1185 100 Plus
X 23542271 X 8237231..8237428 2151..2348 990 100 Plus
X 23542271 X 8238006..8238189 2480..2663 920 100 Plus
X 23542271 X 8230614..8230767 1..154 770 100 Plus
X 23542271 X 8237810..8237942 2349..2481 665 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8243979..8245267 863..2151 6445 100 Plus
X 23527363 X 8246348..8247509 2661..3822 5795 99.9 Plus
X 23527363 X 8240527..8241005 154..632 2395 100 Plus
X 23527363 X 8243683..8243919 628..864 1185 100 Plus
X 23527363 X 8245329..8245526 2151..2348 990 100 Plus
X 23527363 X 8246104..8246287 2480..2663 920 100 Plus
X 23527363 X 8238712..8238865 1..154 770 100 Plus
X 23527363 X 8245908..8246040 2349..2481 665 100 Plus
Blast to na_te.dros performed 2014-11-27 15:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 7095..7218 3352..3234 131 61.1 Minus

RE21473.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:22:53 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8130064..8131216 2663..3815 97   Plus
chrX 8129819..8130000 2481..2662 100 -> Plus
chrX 8129622..8129753 2349..2480 99 -> Plus
chrX 8129044..8129240 2152..2348 100 -> Plus
chrX 8127694..8128981 864..2151 100 -> Plus
chrX 8127404..8127632 635..863 100 -> Plus
chrX 8124249..8124730 154..634 90 -> Plus
chrX 8122435..8122587 1..153 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:29 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..2640 218..2857 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:07 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..2640 218..2857 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:54 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..2640 218..2857 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:22:53 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..2640 218..2857 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 17:04:57 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..3815 1..3815 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:07 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..3815 1..3815 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:54 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..3815 1..3815 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:22:53 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
sdt-RD 1..3815 1..3815 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:22:53 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
X 8238252..8239404 2663..3815 100   Plus
X 8238007..8238188 2481..2662 100 -> Plus
X 8237810..8237941 2349..2480 100 -> Plus
X 8237232..8237428 2152..2348 100 -> Plus
X 8235882..8237169 864..2151 100 -> Plus
X 8235592..8235820 635..863 100 -> Plus
X 8232429..8232910 154..634 99 -> Plus
X 8230614..8230766 1..153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:54 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8132285..8133437 2663..3815 100   Plus
arm_X 8132040..8132221 2481..2662 100 -> Plus
arm_X 8131843..8131974 2349..2480 100 -> Plus
arm_X 8131265..8131461 2152..2348 100 -> Plus
arm_X 8129915..8131202 864..2151 100 -> Plus
arm_X 8129625..8129853 635..863 100 -> Plus
arm_X 8126462..8126943 154..634 99 -> Plus
arm_X 8124647..8124799 1..153 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:08 Download gff for RE21473.complete
Subject Subject Range Query Range Percent Splice Strand
X 8246350..8247502 2663..3815 100   Plus
X 8246105..8246286 2481..2662 100 -> Plus
X 8245908..8246039 2349..2480 100 -> Plus
X 8245330..8245526 2152..2348 100 -> Plus
X 8243980..8245267 864..2151 100 -> Plus
X 8243690..8243918 635..863 100 -> Plus
X 8240527..8241008 154..634 99 -> Plus
X 8238712..8238864 1..153 100 -> Plus

RE21473.pep Sequence

Translation from 217 to 2856

> RE21473.pep
MVVSTLHITLENNGNVAAGQPAAVAAASVVGAATSPTKFAVLSAQQLQLQ
LQQQQQQQNEKENHMNNNNNNSDYCDMNGNGVGMGNGGSGGPGSLTPQSP
DQYVGSPVSSAATPQRTASALRRGIQIQRSSTRLRQQQEQLRRRREEEER
IAQQNEFLRNSLRGSRKLKALQDTATPGKAVAQQQQQATLATQVVGVENE
AYLPDEDQPQAEQIDGYGELIAALTRLQNQLSKSGLSTLAGRVSAAHSVL
ASASVAHVLAARTAVLQRRRSRVSGPLHHSSLGLQKDIVELLTQSNTAAA
IELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTPTPTPAIGAATGSTLSS
PVAGPKRNLGMVVPPPVVPPPLAQRGAMPLPRGESPPPVPMPPLATMPMS
MPVNLPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIV
RGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVP
AGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCR
ELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRET
MKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYA
TTAPDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA
DSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYE
KAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSL
DKLRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAY
HQLLAEINSLEREPQWVPAQWVHNNRDES*

RE21473.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20363-PA 907 GF20363-PA 1..907 1..879 3405 82.9 Plus
Dana\GF12435-PA 556 GF12435-PA 132..555 414..872 882 38.6 Plus
Dana\GF14547-PA 636 GF14547-PA 82..636 276..873 641 28.3 Plus
Dana\GF16967-PA 1169 GF16967-PA 754..1169 421..873 611 31.9 Plus
Dana\GF19077-PA 1005 GF19077-PA 488..1002 422..870 430 27.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19306-PA 1299 GG19306-PA 935..1299 515..879 1932 98.9 Plus
Dere\GG19306-PA 1299 GG19306-PA 622..952 134..462 1322 93.1 Plus
Dere\GG22696-PA 595 GG22696-PA 132..594 414..872 917 39.5 Plus
Dere\GG21549-PA 636 GG21549-PA 82..636 276..873 628 27.8 Plus
Dere\GG22470-PA 315 GG22470-PA 1..315 530..873 489 32.8 Plus
Dere\GG18414-PA 1004 GG18414-PA 487..1001 422..870 435 27.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24103-PA 997 GH24103-PA 229..997 134..879 3058 82.5 Plus
Dgri\GH10158-PA 636 GH10158-PA 182..636 431..873 626 30.8 Plus
Dgri\GH18714-PA 596 GH18714-PA 181..596 421..873 608 31.9 Plus
Dgri\GH21953-PA 242 GH21953-PA 13..241 655..872 525 43.7 Plus
Dgri\GH12185-PA 828 GH12185-PA 357..825 422..870 457 29.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-PK 879 CG32717-PK 1..879 1..879 4501 100 Plus
sdt-PD 879 CG32717-PD 1..879 1..879 4501 100 Plus
sdt-PN 1292 CG32717-PN 421..1292 4..879 3830 87.4 Plus
sdt-PI 1269 CG32717-PI 398..1269 4..879 3830 87.4 Plus
sdt-PE 1367 CG32717-PE 496..1367 4..879 3830 87.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14373-PA 897 GI14373-PA 58..897 48..879 3165 80 Plus
Dmoj\GI19661-PA 556 GI19661-PA 132..555 414..872 885 39.2 Plus
Dmoj\GI22442-PA 634 GI22442-PA 182..634 431..873 649 31.9 Plus
Dmoj\GI22862-PA 594 GI22862-PA 179..594 421..873 614 31.9 Plus
Dmoj\GI15716-PA 833 GI15716-PA 341..830 422..870 444 28.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20368-PA 918 GL20368-PA 1..918 1..879 3220 78.4 Plus
Dper\GL20641-PA 596 GL20641-PA 132..595 414..872 901 39.6 Plus
Dper\GL19590-PA 637 GL19590-PA 172..637 419..873 632 31.1 Plus
Dper\GL23741-PA 487 GL23741-PA 72..487 421..873 625 32.5 Plus
Dper\GL20800-PA 221 GL20800-PA 24..200 679..853 256 35 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17100-PA 1002 GA17100-PA 240..1002 134..879 3116 87.8 Plus
Dpse\GA15582-PB 586 GA15582-PB 132..585 414..872 922 40.4 Plus
Dpse\GA15582-PA 596 GA15582-PA 132..595 414..872 901 39.6 Plus
Dpse\GA21703-PA 637 GA21703-PA 172..637 419..873 634 31.1 Plus
Dpse\GA19796-PA 1027 GA19796-PA 622..1027 421..873 626 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:09:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11239-PA 1309 GM11239-PA 947..1309 517..879 1927 98.9 Plus
Dsec\GM11239-PA 1309 GM11239-PA 633..962 134..462 1278 96.1 Plus
Dsec\GM20471-PA 593 GM20471-PA 130..592 414..872 908 39.3 Plus
Dsec\GM23306-PA 636 GM23306-PA 82..636 276..873 641 28 Plus
Dsec\GM23693-PA 591 GM23693-PA 176..591 421..873 620 32.3 Plus
Dsec\GM25224-PA 234 GM25224-PA 37..213 679..853 267 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25940-PA 377 GD25940-PA 1..376 450..872 811 39.6 Plus
Dsim\GD21680-PA 644 GD21680-PA 90..644 276..873 639 28 Plus
Dsim\GD18503-PA 769 GD18503-PA 354..769 421..873 619 32.3 Plus
Dsim\GD14257-PA 250 GD14257-PA 42..229 679..853 244 33.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:09:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19412-PA 1381 GJ19412-PA 634..1381 134..879 3133 85.8 Plus
Dvir\GJ15026-PA 595 GJ15026-PA 132..594 414..872 903 39.7 Plus
Dvir\GJ20335-PA 634 GJ20335-PA 182..634 431..873 640 31.1 Plus
Dvir\GJ14160-PA 1039 GJ14160-PA 624..1039 421..873 611 31.7 Plus
Dvir\GJ15244-PA 921 GJ15244-PA 347..918 358..870 424 26.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25185-PA 1626 GK25185-PA 876..1626 134..879 3125 86.1 Plus
Dwil\GK20656-PA 599 GK20656-PA 132..598 414..872 889 39.6 Plus
Dwil\GK24864-PA 641 GK24864-PA 184..641 431..873 624 31.4 Plus
Dwil\GK13019-PA 608 GK13019-PA 193..608 421..873 612 31.9 Plus
Dwil\GK16229-PA 996 GK16229-PA 423..993 361..870 436 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15771-PA 1719 GE15771-PA 1355..1719 515..879 1941 98.9 Plus
Dyak\GE15771-PA 1719 GE15771-PA 893..1372 1..462 1545 87.1 Plus
Dyak\GE13049-PA 315 GE13049-PA 1..314 531..872 700 40.8 Plus
Dyak\GE13543-PA 636 GE13543-PA 82..636 276..873 626 27.8 Plus
Dyak\GE24086-PA 594 GE24086-PA 179..594 421..873 620 32.3 Plus
Dyak\GE15932-PA 902 GE15932-PA 385..899 422..870 431 27.2 Plus

RE21473.hyp Sequence

Translation from 524 to 2856

> RE21473.hyp
MSAHLYHPLPRPSAPPPPCVAAFKFNDPRRVCDNNRQQLRRRREEEERIA
QQNEFLRNSLRGSRKLKALQDTATPGKAVAQQQQQATLATQVVGVENEAY
LPDEDQPQAEQIDGYGELIAALTRLQNQLSKSGLSTLAGRVSAAHSVLAS
ASVAHVLAARTAVLQRRRSRVSGPLHHSSLGLQKDIVELLTQSNTAAAIE
LGNLLTSHEMEGLLLAHDRIANHTDGTPSPTPTPTPAIGAATGSTLSSPV
AGPKRNLGMVVPPPVVPPPLAQRGAMPLPRGESPPPVPMPPLATMPMSMP
VNLPMSACFGTLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRG
GAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAG
SPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCREL
GISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRETMK
LAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYATT
APDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADS
ERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKA
YYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDK
LRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQ
LLAEINSLEREPQWVPAQWVHNNRDES*

RE21473.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
sdt-PN 1292 CG32717-PN 551..1292 36..777 3800 99.7 Plus
sdt-PM 1901 CG32717-PM 1160..1901 36..777 3800 99.7 Plus
sdt-PK 879 CG32717-PK 138..879 36..777 3800 99.7 Plus
sdt-PI 1269 CG32717-PI 528..1269 36..777 3800 99.7 Plus
sdt-PE 1367 CG32717-PE 626..1367 36..777 3800 99.7 Plus