Clone RE21773 Report

Search the DGRC for RE21773

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:217
Well:73
Vector:pFlc-1
Associated Gene/TranscriptCp1-RC
Protein status:RE21773.pep: gold
Sequenced Size:1385

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cp1-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE21773.complete Sequence

1385 bp assembled on 2009-08-05

GenBank Submission: BT089036.1

> RE21773.complete
ACCTGATAGCCAGATGAATCACCTTGGCGTTTTTGAAACCCGTTTTCGCC
CTCGAACTAGGCACAAATCGCAGAGGGCACAATTGATTCCAGAACAAATC
ACAATGCGCACAGCTGTTTTGCTGCCACTTTTGGCCCTGCTGGCGGTGGC
TCAGGCCGTTTCCTTCGCCGACGTGGTCATGGAGGAATGGCATACGTTCA
AGCTGGAGCACCGCAAGAACTATCAGGATGAAACCGAGGAGCGTTTCCGC
CTCAAGATCTTCAATGAGAACAAGCACAAGATTGCCAAGCACAACCAGCG
ATTCGCCGAGGGCAAGGTGAGCTTCAAACTGGCGGTCAATAAGTACGCCG
ATTTGCTGCACCACGAATTCCGTCAGCTGATGAACGGCTTCAACTACACT
CTGCACAAGCAACTGCGTGCCGCCGATGAAAGCTTCAAGGGAGTCACCTT
CATCTCGCCGGCTCATGTGACGCTGCCCAAATCTGTGGACTGGCGCACCA
AGGGAGCTGTGACCGCCGTCAAGGATCAGGGACACTGCGGCAGCTGCTGG
GCCTTCTCCAGCACAGGCGCCCTCGAGGGTCAGCATTTCCGCAAGTCCGG
TGTCCTCGTCTCGCTGTCCGAGCAGAATCTGGTCGATTGCTCCACCAAGT
ACGGCAACAATGGATGCAACGGCGGTCTCATGGACAATGCCTTCCGCTAT
ATTAAGGATAATGGAGGCATCGATACCGAGAAGTCCTATCCCTACGAGGC
CATCGATGACTCGTGCCACTTTAACAAGGGCACAGTCGGAGCCACCGATC
GTGGATTCACCGATATTCCCCAGGGTGATGAGAAGAAGATGGCCGAGGCT
GTGGCCACCGTTGGTCCCGTTTCCGTCGCCATCGATGCCTCCCACGAGTC
GTTCCAGTTCTACTCGGAGGGCGTCTACAACGAGCCGCAGTGTGATGCCC
AGAATCTGGATCACGGTGTGCTGGTCGTTGGCTTCGGCACCGACGAGTCC
GGCGAGGATTACTGGCTGGTGAAGAACTCGTGGGGCACCACCTGGGGCGA
CAAGGGCTTCATCAAGATGCTGCGCAACAAGGAGAACCAGTGCGGCATCG
CTAGCGCCTCCAGCTATCCCCTGGTCTAGAGCAGAACTGATGTAGTTTAG
CCCCAGCATTCATATGATATGATTTAGAAAAGAAACAGAAAAGATACCAA
CGCAAGCATCTCAAAAATGAACTTTAATAATTTAGCCCAACCTCATATTT
AATGAACTAATTTTGTAATGGGTCCATTGTATTCGCGTTTCTCTGCCATC
ATGTATGATATAGGTGAACAACAAATCTGTTGATGTTTGTAGAAAAATAA
ATAAAAATTATATAATTTTAAAAAAAAAAAAAAAA

RE21773.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-RC 1379 Cp1-RC 1..1374 1..1374 6870 100 Plus
Cp1-RA 1609 Cp1-RA 253..1543 84..1374 6455 100 Plus
Cp1-RB 1505 Cp1-RB 218..1500 92..1374 6415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9854359..9855311 417..1369 4765 100 Plus
chr2R 21145070 chr2R 9854083..9854299 201..417 1085 100 Plus
chr2R 21145070 chr2R 9849548..9849665 85..202 575 99.2 Plus
chr2R 21145070 chr2R 9848511..9848595 1..85 425 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-RC 1116 CG6692-PC 1..1116 14..1129 5580 100 Plus
Cp1-RA 1026 CG6692-PA 1..1026 104..1129 5130 100 Plus
Cp1-RE 1017 CG6692-PE 90..1017 202..1129 4640 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-RC 1369 CG6692-RC 1..1369 1..1369 6845 100 Plus
Cp1-RA 1486 CG6692-RA 201..1486 84..1369 6430 100 Plus
Cp1-RD 1481 CG6692-RD 313..1481 201..1369 5845 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-PC 371 CG6692-PC 1..371 14..1126 1895 100 Plus
Cp1-PA 341 CG6692-PA 20..341 161..1126 1739 100 Plus
Cp1-PE 338 CG6692-PE 31..338 203..1126 1661 100 Plus
Cp1-PD 249 CG6692-PD 1..249 380..1126 1349 100 Plus
CG4847-PE 390 CG4847-PE 79..390 179..1126 621 41.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13967029..13967986 417..1374 4790 100 Plus
2R 25286936 2R 13966753..13966969 201..417 1085 100 Plus
2R 25286936 2R 13962219..13962336 85..202 590 100 Plus
2R 25286936 2R 13961181..13961265 1..85 425 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13968228..13969185 417..1374 4790 100 Plus
2R 25260384 2R 13967952..13968168 201..417 1085 100 Plus
2R 25260384 2R 13963418..13963535 85..202 590 100 Plus
2R 25260384 2R 13962380..13962464 1..85 425 100 Plus
Blast to na_te.dros performed on 2014-11-27 09:25:46 has no hits.

RE21773.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:21:33 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9854360..9855283 418..1341 100 -> Plus
chr2R 9854085..9854299 203..417 100 -> Plus
chr2R 9849549..9849665 86..202 99 -> Plus
chr2R 9848511..9848595 1..85 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:53 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1116 14..1129 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:56:38 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1116 14..1129 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:19:34 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1116 14..1129 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:21:33 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1116 14..1129 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-05 16:50:50 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1369 1..1369 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:56:38 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1369 1..1369 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:19:34 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1369 1..1369 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:21:33 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
Cp1-RC 1..1369 1..1369 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:21:33 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13967030..13967981 418..1369 100   Plus
2R 13966755..13966969 203..417 100 -> Plus
2R 13962220..13962336 86..202 100 -> Plus
2R 13961181..13961265 1..85 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:19:34 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9854535..9855486 418..1369 100   Plus
arm_2R 9854260..9854474 203..417 100 -> Plus
arm_2R 9849725..9849841 86..202 100 -> Plus
arm_2R 9848686..9848770 1..85 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:10 Download gff for RE21773.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13968229..13969180 418..1369 100   Plus
2R 13967954..13968168 203..417 100 -> Plus
2R 13963419..13963535 86..202 100 -> Plus
2R 13962380..13962464 1..85 100 -> Plus

RE21773.hyp Sequence

Translation from 0 to 1128

> RE21773.hyp
PDSQMNHLGVFETRFRPRTRHKSQRAQLIPEQITMRTAVLLPLLALLAVA
QAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQR
FAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTF
ISPAHVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSG
VLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEA
IDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHES
FQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGD
KGFIKMLRNKENQCGIASASSYPLV*

RE21773.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-PC 371 CG6692-PC 1..371 5..375 1979 100 Plus
Cp1-PA 341 CG6692-PA 1..341 35..375 1822 100 Plus
Cp1-PE 338 CG6692-PE 31..338 68..375 1661 100 Plus
Cp1-PD 249 CG6692-PD 1..249 127..375 1349 100 Plus
CG4847-PE 390 CG4847-PE 79..390 60..375 621 41.7 Plus

RE21773.pep Sequence

Translation from 1 to 1128

> RE21773.pep
PDSQMNHLGVFETRFRPRTRHKSQRAQLIPEQITMRTAVLLPLLALLAVA
QAVSFADVVMEEWHTFKLEHRKNYQDETEERFRLKIFNENKHKIAKHNQR
FAEGKVSFKLAVNKYADLLHHEFRQLMNGFNYTLHKQLRAADESFKGVTF
ISPAHVTLPKSVDWRTKGAVTAVKDQGHCGSCWAFSSTGALEGQHFRKSG
VLVSLSEQNLVDCSTKYGNNGCNGGLMDNAFRYIKDNGGIDTEKSYPYEA
IDDSCHFNKGTVGATDRGFTDIPQGDEKKMAEAVATVGPVSVAIDASHES
FQFYSEGVYNEPQCDAQNLDHGVLVVGFGTDESGEDYWLVKNSWGTTWGD
KGFIKMLRNKENQCGIASASSYPLV*

RE21773.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13722-PA 417 GF13722-PA 107..417 65..375 1593 92.6 Plus
Dana\GF17600-PA 333 GF17600-PA 1..333 35..375 1066 57.9 Plus
Dana\GF17358-PA 329 GF17358-PA 1..329 35..375 910 51.9 Plus
Dana\GF13714-PA 352 GF13714-PA 9..352 35..375 620 39 Plus
Dana\GF13132-PA 392 GF13132-PA 68..392 36..375 620 38.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20414-PA 341 GG20414-PA 1..341 35..375 1726 96.5 Plus
Dere\GG20405-PA 352 GG20405-PA 9..352 35..375 617 37.7 Plus
Dere\GG20691-PA 378 GG20691-PA 53..378 48..375 615 39 Plus
Dere\GG11133-PA 615 GG11133-PA 303..610 57..371 601 39.9 Plus
Dere\GG23942-PA 338 GG23942-PA 35..338 62..375 588 36 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22826-PA 340 GH22826-PA 1..340 35..375 1634 85.9 Plus
Dgri\GH20767-PA 329 GH20767-PA 4..329 40..375 785 46.1 Plus
Dgri\GH21411-PA 391 GH21411-PA 81..391 60..375 624 39.1 Plus
Dgri\GH23906-PA 358 GH23906-PA 48..358 60..375 621 39.1 Plus
Dgri\GH21038-PA 349 GH21038-PA 47..349 72..375 609 40.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Cp1-PC 371 CG6692-PC 1..371 5..375 1979 100 Plus
Cp1-PA 341 CG6692-PA 1..341 35..375 1822 100 Plus
Cp1-PE 338 CG6692-PE 31..338 68..375 1661 100 Plus
Cp1-PD 249 CG6692-PD 1..249 127..375 1349 100 Plus
CG4847-PE 390 CG4847-PE 79..390 60..375 621 41.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21205-PA 339 GI21205-PA 1..339 35..375 1670 88 Plus
Dmoj\GI20850-PA 329 GI20850-PA 4..329 40..375 841 49.1 Plus
Dmoj\GI13676-PA 324 GI13676-PA 1..324 35..375 755 43.9 Plus
Dmoj\GI18587-PA 366 GI18587-PA 62..366 66..375 616 40.1 Plus
Dmoj\GI11630-PA 547 GI11630-PA 239..544 59..372 605 42.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17172-PA 341 GL17172-PA 1..341 35..375 1732 91.8 Plus
Dper\GL15686-PA 323 GL15686-PA 1..323 35..375 708 42.6 Plus
Dper\GL11434-PA 372 GL11434-PA 61..372 60..375 627 39.8 Plus
Dper\GL17477-PA 353 GL17477-PA 9..353 35..375 624 38.6 Plus
Dper\GL24978-PA 338 GL24978-PA 20..338 52..375 580 37.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25021-PA 341 GA25021-PA 1..341 35..375 1731 91.8 Plus
Dpse\GA25021-PB 319 GA25021-PB 11..319 67..375 1580 92.9 Plus
Dpse\GA23505-PA 323 GA23505-PA 1..323 35..375 713 42.9 Plus
Dpse\GA18475-PA 372 GA18475-PA 61..372 60..375 626 39.5 Plus
Dpse\GA24205-PA 353 GA24205-PA 9..353 35..375 624 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21500-PA 341 GM21500-PA 1..341 35..375 1842 99.1 Plus
Dsec\GM21493-PA 352 GM21493-PA 9..352 35..375 635 39.1 Plus
Dsec\GM21790-PA 382 GM21790-PA 71..382 60..375 628 41.1 Plus
Dsec\GM10853-PA 336 GM10853-PA 2..336 33..375 583 37.2 Plus
Dsec\GM11735-PA 338 GM11735-PA 35..338 62..375 577 35 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10995-PA 341 GD10995-PA 1..341 35..375 1841 99.1 Plus
Dsim\GD10987-PA 352 GD10987-PA 9..352 35..375 633 39.1 Plus
Dsim\GD11280-PA 382 GD11280-PA 71..382 60..375 630 41.1 Plus
Dsim\GD14469-PA 549 GD14469-PA 241..546 59..372 591 41.7 Plus
Dsim\GD19835-PA 336 GD19835-PA 2..336 33..375 585 37 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20806-PA 339 GJ20806-PA 3..339 39..375 1655 87.8 Plus
Dvir\GJ20585-PA 333 GJ20585-PA 4..333 40..375 850 48.1 Plus
Dvir\GJ14012-PA 327 GJ14012-PA 1..327 35..374 800 44.4 Plus
Dvir\GJ13554-PA 331 GJ13554-PA 1..331 35..375 776 45.9 Plus
Dvir\GJ11310-PA 328 GJ11310-PA 7..327 43..374 740 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19626-PA 341 GK19626-PA 1..341 35..375 1582 81.8 Plus
Dwil\GK22909-PA 370 GK22909-PA 59..370 60..375 605 39 Plus
Dwil\GK22908-PA 381 GK22908-PA 71..381 60..375 594 39.3 Plus
Dwil\GK14287-PA 610 GK14287-PA 297..609 57..375 586 37.5 Plus
Dwil\GK16790-PA 549 GK16790-PA 241..546 59..372 580 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12574-PA 341 GE12574-PA 1..341 35..375 1735 97.9 Plus
Dyak\GE12565-PA 353 GE12565-PA 9..353 35..375 623 38.8 Plus
Dyak\GE11675-PA 384 GE11675-PA 61..384 50..375 621 39.6 Plus
Dyak\GE26053-PA 338 GE26053-PA 35..338 62..375 600 36.6 Plus
Dyak\GE10178-PA 336 GE10178-PA 2..336 33..375 590 37.1 Plus