Clone RE22452 Report

Search the DGRC for RE22452

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:224
Well:52
Vector:pFlc-1
Associated Gene/TranscriptSxl-RC
Protein status:RE22452.pep: gold
Sequenced Size:2434

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Sxl-RC 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE22452.complete Sequence

2434 bp assembled on 2011-01-11

GenBank Submission: BT125904.1

> RE22452.complete
AGTCAAGTTCCACTCGTGACAAGTCCAACTTGTGTTCAGAGATCTTGTGA
TTTCTTGTGTGTCTTACATTCAATTTGTTGAAAAACGTAACTTTGTGATT
ATCCCATTATGGATTTCAATTTTGATACTGTGACTCCCTGTTCGACCATG
TCGTCCTACTATAACTTTAAGATGGCGAGTGGTGGGCGTGGATTTGGGAT
GTCCCATTCTCTGCCATCCGGAATGGATACAGAATTTTCATTTCCAAGTT
CATCGTCGCGTCGTGGTTACAATGATTTCCCCGGCTGCGGCGGCAGCGGC
GGAAATGGTGGGAGTGCCAACAATTTAGGGGGCGGCAACATGTGCCACCT
GCCGCCGATGGCCAGCAACAACTCGCTGAATAATCTCTGCGGATTGTCGC
TGGGCAGCGGTGGTAGTGATGATCTCATGAACGATCCTCGGGCAAGCAAC
ACCAACCTGATTGTCAACTACTTGCCCCAGGACATGACCGATCGCGAGCT
GTACGCCCTATTCAGAGCCATTGGACCCATCAACACGTGCAGAATCATGC
GAGACTATAAGACTGGCTACAGTTTTGGTTATGCTTTCGTGGACTTCACA
TCGGAAATGGACTCGCAGCGTGCTATTAAAGTGCTGAATGGCATCACAGT
GCGCAACAAGCGGCTTAAGGTTTCCTATGCACGTCCCGGCGGAGAATCGA
TCAAGGACACCAATCTGTATGTGACCAATCTGCCGCGTACCATAACCGAC
GATCAGCTGGACACGATCTTCGGCAAGTACGGTTCCATTGTGCAGAAGAA
CATCTTGCGTGACAAGCTCACAGGTCGTCCTCGTGGTGTGGCCTTTGTTC
GGTACAACAAGCGTGAGGAGGCCCAGGAGGCCATTTCGGCGCTGAACAAC
GTAATACCCGAGGGCGGATCACAGCCGCTGTCCGTCCGGTTGGCTGAGGA
GCATGGCAAGGCGAAGGCGGCCCACTTTATGTCGCAGATGGGCGTGGTTC
CAGCAAATGTACCACCGCCGCCACCACAACCGCCAGCACATATGGCCGCC
GCATTCAACATGATGCACAGAGGTAGATCAATTAAATCACAGCAACGCTT
CCAAAACTCGCATCCCTATTTCGATGCTAAAAAGTTTATCTGAAATACAA
ATATCCAGAAACGAATACAAGATGAAACACACAAGCCACACACAAAATAT
AATCAAGAGCGATCTGCTGGGTATATAGTGAATACATATATACCAATTAA
TCTTGAGAGTGTTTACATCTGAAACCCTTGATTCATTTTGTTTCTTTTGG
TATTTCACAAACAACAACAACAAAACAGCAGGCTACGAAAAACAATCCAA
CCAACAACAAACATAACACTAACAACCAACAACAATATGAATGCATACTT
AGTTTTATTATTTGCTCTTAATTCGGTAATTCGTAAATAATTCAATTTAT
TGTTGCAATTTCGCAGTGCATATATATTATACTAATATATATGTCGTATA
TTTTGATAAAAAAAAAAAACACAAAAATTGAATTGTATTTAAATTTTTTA
GTGTAATTGAAAAATATAACAAAACTAAAAAAAAAAATTAAAAATCATTT
GGAAAACGTAAAAAAAAGTAACTTTTAGATACTAACCTACAACTAAAAAG
AGAAAGGGAAATATCACGTTTTTTTTGTTTAGGCTTAAATCTTAAGCTTT
TCTTTCACAACTTTGACAACAGAACTCACAACTACACACACACACATACA
CAAAACCAGGCGAAACGGTAAACTAGCACTTCAAAGTTCGCGTAAAAGTG
TTAGTCAAAAACCATTTTTTTAAACTTTTTTTTATGTGTGTGTTTTCCAA
AGCGGAAAATTTTTTTTTCCCGGATACAGCACAATAACAAAACGTAAAGC
TGCAATTTTTTTTATACAAATAAAAAATACCGAAATGCACATAATGAGTA
ATATATATTAACAACAAAGAGATAAACCAACCAAGGACTGAATCGATACC
TAACTAAAAAAGCAAGAAATGCATAACCCACTAAAAAAGATGATATATAT
CCTTCTTGAACGAAGCTAAAGAGTGCAATTTTTTTTGATCCTAGTTATTT
TTTTTGGTAATTTTTTTCCCGTTTACACAAAAGACTGGTGCGAGACAACA
GAAGATTAAACAAACATTGCAATCAAGCAATCAGAACTGAATTATAAAAG
TAAAACAAATCACGATATAAAATACAAATCTAAAGGAGTAAAAATTACAA
AAGCGTTGCCGAGCATTAACCTGTAACCCTTTTAGATCCACTTACCTCTT
CAGCATCTTCAGATCGCATCAATAATATTGAAATCGAATCACGCCTTTTT
TTTTGGTTTTAATTTGCCCATCTCTACCAGCGACAACAACTACAATCTAC
TGCAAGATAAACAACAAGAAAAAAAAAAAGAAAA

RE22452.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6975205..6976783 2428..851 7830 99.9 Minus
chrX 22417052 chrX 6977582..6977918 561..225 1685 100 Minus
chrX 22417052 chrX 6977119..6977304 853..668 930 100 Minus
chrX 22417052 chrX 6984660..6984838 179..1 880 99.4 Minus
chrX 22417052 chrX 6977371..6977482 671..560 560 100 Minus
chrX 22417052 chrX 6979576..6979624 226..178 245 100 Minus
chrX 22417052 chrX 1265596..1265702 450..556 205 79.4 Plus
chrX 22417052 chrX 1266395..1266531 853..989 205 76.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-RC 1035 CG43770-PC 1..1035 109..1143 5175 100 Plus
Sxl-RN 1035 CG43770-PN 1..1035 109..1143 5175 100 Plus
Sxl-RJ 1041 CG43770-PJ 74..1041 176..1143 4840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-RN 2758 CG43770-RN 9..2437 1..2428 12065 99.9 Plus
Sxl-RG 3227 CG43770-RG 653..2906 176..2428 11205 99.9 Plus
Sxl-RE 2863 CG43770-RE 293..2542 180..2428 11185 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-PC 344 CG43770-PC 1..344 109..1140 1452 100 Plus
Sxl-PN 344 CG43770-PN 1..344 109..1140 1452 100 Plus
Sxl-PR 342 CG43770-PR 1..324 109..1080 1337 99.4 Plus
Sxl-PJ 346 CG43770-PJ 21..346 160..1140 1329 99.1 Plus
Sxl-PG 346 CG43770-PG 21..346 160..1140 1329 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7083242..7084820 2428..851 7830 99.9 Minus
X 23542271 X 7085619..7085955 561..225 1685 100 Minus
X 23542271 X 7085156..7085341 853..668 930 100 Minus
X 23542271 X 7092697..7092875 179..1 880 99.4 Minus
X 23542271 X 7085408..7085519 671..560 560 100 Minus
X 23542271 X 7087613..7087661 226..178 245 100 Minus
X 23542271 X 1371663..1371769 450..556 205 79.4 Plus
X 23542271 X 1372462..1372598 853..989 205 76.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7091340..7092918 2428..851 7840 99.8 Minus
X 23527363 X 7093717..7094053 561..225 1685 100 Minus
X 23527363 X 7093254..7093439 853..668 930 100 Minus
X 23527363 X 7100795..7100973 179..1 880 99.4 Minus
X 23527363 X 7093506..7093617 671..560 560 100 Minus
X 23527363 X 7095711..7095759 226..178 245 100 Minus
X 23527363 X 1379761..1379867 450..556 205 79.4 Plus
Blast to na_te.dros performed 2014-11-27 16:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 724..889 1881..2048 185 60.6 Plus

RE22452.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:59:51 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6984660..6984838 1..179 99   Minus
chrX 6979577..6979622 180..225 100 <- Minus
chrX 6977582..6977917 226..561 100 <- Minus
chrX 6977373..6977480 562..669 100 <- Minus
chrX 6977121..6977302 670..851 100 <- Minus
chrX 6976325..6976782 852..1309 100 <- Minus
chrX 6976138..6976246 1388..1496 100 == Minus
chrX 6975215..6976038 1596..2418 99 == Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-11 10:26:28 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RC 1..1035 109..1143 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:40:43 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RN 1..1035 109..1143 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:59:51 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RN 1..1035 109..1143 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:26:28 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RN 3..2421 1..2418 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:40:43 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RN 9..2427 1..2418 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:59:51 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
Sxl-RN 9..2427 1..2418 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:59:51 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
X 7092697..7092875 1..179 99   Minus
X 7087614..7087659 180..225 100 <- Minus
X 7085619..7085954 226..561 100 <- Minus
X 7085410..7085517 562..669 100 <- Minus
X 7085158..7085339 670..851 100 <- Minus
X 7083252..7084819 852..2418 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:40:43 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6986730..6986908 1..179 99   Minus
arm_X 6981647..6981692 180..225 100 <- Minus
arm_X 6979652..6979987 226..561 100 <- Minus
arm_X 6979443..6979550 562..669 100 <- Minus
arm_X 6979191..6979372 670..851 100 <- Minus
arm_X 6977285..6978852 852..2418 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:55:02 Download gff for RE22452.complete
Subject Subject Range Query Range Percent Splice Strand
X 7100795..7100973 1..179 99   Minus
X 7095712..7095757 180..225 100 <- Minus
X 7093717..7094052 226..561 100 <- Minus
X 7093508..7093615 562..669 100 <- Minus
X 7093256..7093437 670..851 100 <- Minus
X 7091350..7092917 852..2418 99 <- Minus

RE22452.pep Sequence

Translation from 108 to 1142

> RE22452.pep
MDFNFDTVTPCSTMSSYYNFKMASGGRGFGMSHSLPSGMDTEFSFPSSSS
RRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGS
GGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDY
KTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKD
TNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYN
KREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPAN
VPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFI*

RE22452.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 13:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20968-PA 379 GF20968-PA 21..309 18..296 1188 89.3 Plus
Dana\GF21012-PA 757 GF21012-PA 104..287 111..294 786 78.8 Plus
Dana\GF18529-PA 417 GF18529-PA 139..311 112..284 439 48 Plus
Dana\GF14992-PA 660 GF14992-PA 95..267 109..279 423 43.8 Plus
Dana\GF21392-PA 353 GF21392-PA 15..216 102..290 418 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 13:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17637-PA 335 GG17637-PA 1..292 31..321 1268 97.3 Plus
Dere\GG12847-PA 513 GG12847-PA 97..280 111..294 789 78.8 Plus
Dere\GG24901-PA 446 GG24901-PA 109..281 109..279 416 43.8 Plus
Dere\GG12756-PA 466 GG12756-PA 132..314 102..283 416 42.1 Plus
Dere\GG17743-PA 353 GG17743-PA 15..216 102..290 414 39.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 13:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24172-PA 365 GH24172-PA 21..322 18..321 1292 86.5 Plus
Dgri\GH12116-PA 918 GH12116-PA 177..358 109..290 744 75.8 Plus
Dgri\GH13638-PA 726 GH13638-PA 110..277 109..279 432 44.4 Plus
Dgri\GH24423-PA 353 GH24423-PA 15..216 102..290 414 39.7 Plus
Dgri\GH12602-PA 511 GH12602-PA 162..359 100..283 394 38.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-PC 344 CG43770-PC 1..344 1..344 1823 100 Plus
Sxl-PN 344 CG43770-PN 1..344 1..344 1823 100 Plus
Sxl-PR 342 CG43770-PR 1..324 1..324 1708 99.4 Plus
Sxl-PJ 346 CG43770-PJ 21..346 18..344 1700 99.1 Plus
Sxl-PG 346 CG43770-PG 21..346 18..344 1700 99.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 13:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21573-PA 367 GI21573-PA 19..324 18..321 1328 87.5 Plus
Dmoj\GI16327-PA 716 GI16327-PA 246..443 111..312 776 75.2 Plus
Dmoj\GI11879-PA 724 GI11879-PA 121..293 109..279 422 43.8 Plus
Dmoj\GI16282-PA 353 GI16282-PA 13..216 100..290 414 39.3 Plus
Dmoj\GI10157-PA 356 GI10157-PA 31..196 115..280 392 45.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 13:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26885-PA 377 GL26885-PA 19..334 18..321 1243 86.8 Plus
Dper\GL14245-PA 618 GL14245-PA 114..299 109..294 740 72.6 Plus
Dper\GL26299-PA 678 GL26299-PA 107..274 109..279 437 45 Plus
Dper\GL22975-PA 385 GL22975-PA 13..216 100..290 413 39.3 Plus
Dper\GL20165-PA 496 GL20165-PA 153..344 99..283 386 39.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 13:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22653-PA 377 GA22653-PA 19..334 18..321 1243 86.8 Plus
Dpse\GA22715-PA 672 GA22715-PA 114..298 109..293 740 73 Plus
Dpse\GA28809-PA 692 GA28809-PA 116..288 109..279 420 43.8 Plus
Dpse\GA22283-PA 353 GA22283-PA 13..216 100..290 414 39.3 Plus
Dpse\GA18065-PA 496 GA18065-PA 153..344 99..283 386 39.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 13:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Sxl-PA 301 GM17480-PA 21..290 18..288 1195 97 Plus
Dsec\GM19131-PA 488 GM19131-PA 89..272 111..294 782 78.8 Plus
Dsec\GM18380-PA 650 GM18380-PA 313..485 109..279 417 43.8 Plus
Dsec\GM19036-PA 466 GM19036-PA 132..314 102..283 415 42.1 Plus
Dsec\GM11591-PA 379 GM11591-PA 41..231 102..279 406 40.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 13:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Sxl-PA 301 GD16165-PA 21..253 18..251 1012 97.4 Plus
Dsim\GD16553-PA 226 GD16553-PA 89..226 111..248 575 77.5 Plus
Dsim\GD16475-PA 466 GD16475-PA 132..314 102..283 415 42.1 Plus
Dsim\GD17091-PA 371 GD17091-PA 13..219 100..290 413 39.2 Plus
Dsim\GD23195-PA 464 GD23195-PA 312..460 109..255 368 45.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 13:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Sxl-PA 368 GJ16698-PA 19..325 18..321 1335 87.5 Plus
Dvir\ssx-PA 428 GJ15667-PA 26..197 124..295 725 79.7 Plus
Dvir\GJ13991-PA 725 GJ13991-PA 99..271 109..279 423 43.8 Plus
Dvir\GJ16518-PA 353 GJ16518-PA 15..216 102..290 414 39.7 Plus
Dvir\GJ10859-PA 388 GJ10859-PA 23..194 109..280 397 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 13:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16445-PA 373 GK16445-PA 19..330 18..321 1335 89.8 Plus
Dwil\GK16696-PA 508 GK16696-PA 106..292 109..295 779 77 Plus
Dwil\GK14865-PA 725 GK14865-PA 118..290 109..279 418 43.8 Plus
Dwil\GK25647-PA 353 GK25647-PA 15..216 102..290 414 39.7 Plus
Dwil\GK16120-PA 509 GK16120-PA 160..357 100..283 395 38.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 13:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17544-PA 335 GE17544-PA 1..292 31..321 1268 97.3 Plus
Dyak\GE16683-PA 563 GE16683-PA 109..292 111..294 783 78.8 Plus
Dyak\GE18193-PA 446 GE18193-PA 109..281 109..279 416 43.8 Plus
Dyak\fne-PA 353 GE17033-PA 15..216 102..290 414 39.7 Plus
Dyak\GE16581-PA 478 GE16581-PA 131..326 102..283 390 39.3 Plus

RE22452.hyp Sequence

Translation from 108 to 1142

> RE22452.hyp
MDFNFDTVTPCSTMSSYYNFKMASGGRGFGMSHSLPSGMDTEFSFPSSSS
RRGYNDFPGCGGSGGNGGSANNLGGGNMCHLPPMASNNSLNNLCGLSLGS
GGSDDLMNDPRASNTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDY
KTGYSFGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARPGGESIKD
TNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKLTGRPRGVAFVRYN
KREEAQEAISALNNVIPEGGSQPLSVRLAEEHGKAKAAHFMSQMGVVPAN
VPPPPPQPPAHMAAAFNMMHRGRSIKSQQRFQNSHPYFDAKKFI*

RE22452.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
Sxl-PC 344 CG43770-PC 1..344 1..344 1823 100 Plus
Sxl-PN 344 CG43770-PN 1..344 1..344 1823 100 Plus
Sxl-PR 342 CG43770-PR 1..324 1..324 1708 99.4 Plus
Sxl-PJ 346 CG43770-PJ 21..346 18..344 1700 99.1 Plus
Sxl-PG 346 CG43770-PG 21..346 18..344 1700 99.1 Plus