Clone RE22940 Report

Search the DGRC for RE22940

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:229
Well:40
Vector:pFlc-1
Associated Gene/TranscriptCG6933-RC
Protein status:RE22940.pep: gold
Sequenced Size:1295

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6933-RC 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE22940.complete Sequence

1295 bp assembled on 2010-12-06

GenBank Submission: BT125815.1

> RE22940.complete
AGTAACGAAATCGGAACGTTCGCTTCGGTCGTCTGTCTATCAAGTGAATT
TGTCCCCGAAAAATATTAGCATTCCAAGATGGGAGGTACGTTGGCTCGAA
GAACGGATACAGTTATCTCAGCAATCAATATGAGGATCTGTGTCGTGGCC
GCATGTCTCCTAATGGCATCGCAGGCCACCGGCTACACGATGGATGATCT
GTGCCAACAGTGGTCGGGCTATGGATACATCGGCAATCCGAGCAACTGCC
ATGCCTGGGGATACTGCAAGAACCAGGAGGTTGTGGCCTGGGGCACCTGT
CCCAACGGCTTGGTGTTCAACGCGCAGGCCGGCAGCTGTGATTACGCTAA
TACCACGGTGTGCTCCACCAGTGCCGTTGAGACATGCTCCAACGTCAAAT
CTCCCATGTATGTGGCCAATCCGTTGAACTGCACCGAATACGCCTACTGC
GATGGCACAGGCCAAATCTCCTATGGCGATTGCGGCACCGGCGGCGTCTA
TTCGGCATCCTCCACAAAATGTATATGGGGACCCGCCTGCCCGCAGGACA
CCATCTGTCGGTTCATGTTGTCCAACATCTTTGTAGGCGATCCGAACCAG
TGCGGCAACTACATCAACTGCGTCAACGGCTATGGCACTTCCGAAAAATG
TTCCAGCACCGCCAATCCCTACTATAATAAAGCCACTGGCAACTGCCAGT
CGACGAATCCGTGCACCGGCGAAGATTCAAACAGTGGAAACTCTGACCAG
TTCACTGTTGGGCAAACAAATGCAACTGCTTGTGACGAAGAAGCTTTTAA
AGCAGCAGATCCACTTACTGTAAATGGGGAATCTGTTGACTATAGGTACG
TTTCTGATGGTGTCACCTGCTATGGGTACTACTACTGTGCAGCAGTAAAC
GCCACTGGCTATTGGAACCAATGTCCCACCGGTACCCAATTCAATGCTGG
CAAGTGCGTTTCGCCAGCCTCCTTTGTCTGTACCCATAACCGATGTGGGA
ACGTTAACAATCCATTCATGGCAGATGAGGGTTGCAAGAACTACACAATC
TGCTCCAGCGGAATAACCGGATCATGTCCCACCAATGCGCCGTACTACGA
CGAGGTGAACAATATCTGCACCACCAAAATTCCCGATTACGCCATTTGTA
ATTCGACGGCTAGTACATGAGCATCTCCTCCAGCCACGTCTGTTTGCCGA
GATACCTTTTATGAAATATATAAATAAATACCAATGCTGAAGGCATTCAA
AAGAAACTAATAAAAATGTTGACTTCGACCAAAAAAAAAAAAAAA

RE22940.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20207684..20208844 1280..120 5790 99.9 Minus
chr3L 24539361 chr3L 20209240..20209360 121..1 605 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-RD 1092 CG6933-PD 1..1092 79..1170 5460 100 Plus
CG6933-RC 1092 CG6933-PC 1..1092 79..1170 5460 100 Plus
CG6933-RE 1056 CG6933-PE 6..1056 120..1170 5255 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-RD 1413 CG6933-RD 131..1410 1..1280 6400 100 Plus
CG6933-RC 1283 CG6933-RC 1..1280 1..1280 6400 100 Plus
CG6933-RE 1377 CG6933-RE 214..1374 120..1280 5805 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-PD 363 CG6933-PD 1..358 79..1152 2027 100 Plus
CG6933-PC 363 CG6933-PC 1..358 79..1152 2027 100 Plus
CG6933-PE 351 CG6933-PE 1..346 115..1152 1960 99.4 Plus
CG6933-PB 351 CG6933-PB 1..346 115..1152 1960 99.4 Plus
CG6933-PA 351 CG6933-PA 1..346 115..1152 1960 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20218503..20219665 1282..120 5815 100 Minus
3L 28110227 3L 20220061..20220181 121..1 605 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20211603..20212765 1282..120 5815 100 Minus
3L 28103327 3L 20213161..20213281 121..1 605 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:32:10 has no hits.

RE22940.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:07 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20209240..20209360 1..121 100   Minus
chr3L 20207684..20208842 122..1280 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-06 17:16:16 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 1..1092 79..1170 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:33:34 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 1..1092 79..1170 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:07 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 1..1092 79..1170 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-06 17:16:16 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 1..1280 1..1280 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:33:34 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 1..1280 1..1280 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:07 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6933-RC 1..1280 1..1280 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:07 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20220061..20220181 1..121 100   Minus
3L 20218505..20219663 122..1280 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:33:34 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20213161..20213281 1..121 100   Minus
arm_3L 20211605..20212763 122..1280 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:10 Download gff for RE22940.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20213161..20213281 1..121 100   Minus
3L 20211605..20212763 122..1280 100 <- Minus

RE22940.pep Sequence

Translation from 78 to 1169

> RE22940.pep
MGGTLARRTDTVISAINMRICVVAACLLMASQATGYTMDDLCQQWSGYGY
IGNPSNCHAWGYCKNQEVVAWGTCPNGLVFNAQAGSCDYANTTVCSTSAV
ETCSNVKSPMYVANPLNCTEYAYCDGTGQISYGDCGTGGVYSASSTKCIW
GPACPQDTICRFMLSNIFVGDPNQCGNYINCVNGYGTSEKCSSTANPYYN
KATGNCQSTNPCTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNG
ESVDYRYVSDGVTCYGYYYCAAVNATGYWNQCPTGTQFNAGKCVSPASFV
CTHNRCGNVNNPFMADEGCKNYTICSSGITGSCPTNAPYYDEVNNICTTK
IPDYAICNSTAST*

RE22940.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24478-PA 354 GF24478-PA 1..347 13..357 914 52.6 Plus
Dana\GF24502-PA 329 GF24502-PA 1..325 28..357 499 32.8 Plus
Dana\GF25312-PA 347 GF25312-PA 38..337 51..363 216 26.1 Plus
Dana\GF25314-PA 336 GF25314-PA 30..326 39..351 189 24 Plus
Dana\GF25313-PA 317 GF25313-PA 30..316 39..357 185 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13333-PA 360 GG13333-PA 1..360 1..358 1450 76.4 Plus
Dere\GG13872-PA 411 GG13872-PA 79..407 23..357 520 31 Plus
Dere\GG16084-PA 352 GG16084-PA 1..337 16..363 242 27.1 Plus
Dere\GG16087-PA 333 GG16087-PA 27..333 39..358 185 25 Plus
Dere\GG13869-PA 322 GG13869-PA 1..322 27..359 178 24.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15114-PA 309 GH15114-PA 1..309 38..363 683 43.6 Plus
Dgri\GH16715-PA 329 GH16715-PA 1..325 38..357 495 36.6 Plus
Dgri\GH16336-PA 324 GH16336-PA 1..304 51..363 237 26 Plus
Dgri\GH14443-PA 346 GH14443-PA 11..346 20..358 222 26.4 Plus
Dgri\GH15115-PA 336 GH15115-PA 8..334 37..357 199 25.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-PD 363 CG6933-PD 1..363 1..363 2049 100 Plus
CG6933-PC 363 CG6933-PC 1..363 1..363 2049 100 Plus
CG6933-PE 351 CG6933-PE 1..351 13..363 1982 99.4 Plus
CG6933-PB 351 CG6933-PB 1..351 13..363 1982 99.4 Plus
CG6933-PA 351 CG6933-PA 1..351 13..363 1982 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13765-PA 337 GI13765-PA 1..332 13..357 682 41.7 Plus
Dmoj\GI13796-PA 398 GI13796-PA 56..394 13..357 510 33.8 Plus
Dmoj\GI11529-PA 334 GI11529-PA 11..324 20..351 229 25.3 Plus
Dmoj\GI11528-PA 316 GI11528-PA 1..302 51..363 211 28.2 Plus
Dmoj\GI13577-PA 353 GI13577-PA 33..342 40..360 208 25.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25048-PA 344 GL25048-PA 1..340 13..357 875 54.3 Plus
Dper\GL25118-PA 371 GL25118-PA 1..334 16..362 234 25.2 Plus
Dper\GL25120-PA 338 GL25120-PA 14..325 21..351 223 27.2 Plus
Dper\GL25119-PA 336 GL25119-PA 8..336 16..357 218 26.5 Plus
Dper\GL25049-PA 401 GL25049-PA 74..396 37..357 173 24.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19965-PA 344 GA19965-PA 1..343 13..360 885 54.1 Plus
Dpse\GA23601-PA 323 GA23601-PA 1..319 38..357 476 32.7 Plus
Dpse\GA20015-PA 369 GA20015-PA 1..334 16..362 234 25.2 Plus
Dpse\GA14346-PA 336 GA14346-PA 8..336 16..357 222 26 Plus
Dpse\GA23689-PA 338 GA23689-PA 14..325 21..351 219 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:38:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22238-PA 348 GM22238-PA 1..347 13..357 1427 80.7 Plus
Dsec\GM24694-PA 415 GM24694-PA 82..411 23..357 555 34.2 Plus
Dsec\GM22259-PA 360 GM22259-PA 1..337 16..363 247 25.2 Plus
Dsec\GM22261-PA 338 GM22261-PA 2..328 16..351 206 25.3 Plus
Dsec\GM22260-PA 341 GM22260-PA 34..341 39..359 202 26.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12208-PA 348 GD12208-PA 1..347 13..357 1483 81.3 Plus
Dsim\GD12764-PA 415 GD12764-PA 82..411 23..357 558 34.5 Plus
Dsim\GD14858-PA 358 GD14858-PA 1..337 16..363 234 24.4 Plus
Dsim\GD14859-PA 334 GD14859-PA 10..334 22..359 211 26 Plus
Dsim\GD12761-PA 340 GD12761-PA 6..340 14..359 197 24.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11664-PA 325 GJ11664-PA 1..321 38..357 536 36.4 Plus
Dvir\GJ13756-PA 477 GJ13756-PA 15..313 25..329 387 34.7 Plus
Dvir\GJ13756-PA 477 GJ13756-PA 121..477 12..359 221 24.9 Plus
Dvir\GJ11548-PA 334 GJ11548-PA 7..324 16..351 211 25.5 Plus
Dvir\GJ17080-PA 329 GJ17080-PA 24..329 38..357 199 25.4 Plus
Dvir\GJ11547-PA 349 GJ11547-PA 42..336 51..357 196 26 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17243-PA 721 GK17243-PA 15..360 23..329 641 41.9 Plus
Dwil\GK16940-PA 338 GK16940-PA 1..297 51..358 220 27.1 Plus
Dwil\GK16942-PA 338 GK16942-PA 7..328 18..351 220 26.9 Plus
Dwil\GK13618-PA 345 GK13618-PA 5..345 13..362 197 22.9 Plus
Dwil\GK16941-PA 323 GK16941-PA 18..323 39..357 189 24.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22425-PA 349 GE22425-PA 1..349 13..360 1358 73.7 Plus
Dyak\GE14716-PA 199 GE14716-PA 1..199 163..360 719 71 Plus
Dyak\GE20164-PA 379 GE20164-PA 47..375 23..357 527 33 Plus
Dyak\GE23066-PA 358 GE23066-PA 6..337 20..363 220 24.7 Plus
Dyak\GE19648-PA 358 GE19648-PA 6..337 20..363 220 24.7 Plus

RE22940.hyp Sequence

Translation from 78 to 1169

> RE22940.hyp
MGGTLARRTDTVISAINMRICVVAACLLMASQATGYTMDDLCQQWSGYGY
IGNPSNCHAWGYCKNQEVVAWGTCPNGLVFNAQAGSCDYANTTVCSTSAV
ETCSNVKSPMYVANPLNCTEYAYCDGTGQISYGDCGTGGVYSASSTKCIW
GPACPQDTICRFMLSNIFVGDPNQCGNYINCVNGYGTSEKCSSTANPYYN
KATGNCQSTNPCTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNG
ESVDYRYVSDGVTCYGYYYCAAVNATGYWNQCPTGTQFNAGKCVSPASFV
CTHNRCGNVNNPFMADEGCKNYTICSSGITGSCPTNAPYYDEVNNICTTK
IPDYAICNSTAST*

RE22940.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6933-PD 363 CG6933-PD 1..363 1..363 2049 100 Plus
CG6933-PC 363 CG6933-PC 1..363 1..363 2049 100 Plus
CG6933-PE 351 CG6933-PE 1..351 13..363 1982 99.4 Plus
CG6933-PB 351 CG6933-PB 1..351 13..363 1982 99.4 Plus
CG6933-PA 351 CG6933-PA 1..351 13..363 1982 99.4 Plus