Clone RE23444 Report

Search the DGRC for RE23444

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:234
Well:44
Vector:pFlc-1
Associated Gene/TranscriptRbp2-RB
Protein status:RE23444.pep: gold
Sequenced Size:1826

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rbp2-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE23444.complete Sequence

1826 bp assembled on 2011-01-31

GenBank Submission: BT125964.1

> RE23444.complete
AAAAACATGGCTGGAAGAGGTGGTTATGAACACGCTAGCGGATTCGGTGG
GGATCGGGCATCCAAGCAGTTGCCCACGGAACCGCCGTTCATCGCATTTG
TCGGCAATTTGCCGCAAGGCCTTGTGCAGGGCGATGTGATCAAAATATTC
CAGGACTTTGAGGTGAAGTACGTGCGGCTGGTGAAGGACCGGGAAACGGA
TCAGTTCAAAGGCTTCTGCTACGTCGAATTCGAGACGCTGGACAATCTGG
AGCGGGCGCTAGAGTGCGATGGTCGGATCAAACTGGACGATCTGTCGGCG
CCGCTAAGGATCGACATTGCCGATCGGAGAAAAAATGATCGCCCTGGTGG
CGGTGTTGGCGGCGGCAACGGCGGCATGACCCGCGGCGACGGCGGCAGAG
ACGGTTTCCAGAAGCGCGGCCCACCTCGCCAGGGCGGCAGCAGTCAGTCC
TACAGCCGGGGAGGTCCTGGCACTGGCGGCGGCGGTCGGGAGGGCGGCGG
CGGTTCGGGTAATCGCGGCGATAGTAGAGATCGGCCGGCAAATCGTGGTC
GGTACGGCAGTTTCAATAACGACGATCGACCATTCGAGCGTAACCAGGAT
CGGGATCGCGGTCAGCGGGAAGGCAGCTATGGCAACCAGTCGCGCGACGG
CGATCGCTACAACAACTTCAACCGGCACCGCGACCGCGAGCGCACCCACT
ACAATCCCAACCAGCAGAGCGAACGTCCCAGTGGCGGCATGACCGGCCTT
GGCGGCGGCTCCGGCGGATCAGGAGGCCTAGGCGTTGGCGGTGGTTCCTC
AATGGGCGCCATTGACGACAATGAGCGGCCACGTCTGCAGCTGAAGCCAC
GGACCATTGCCGCGCCCATTAACGCGGTGGCAGAGACCAAGCAATCGGCC
TCGATCTTTGGCAACGCCAAGCCGCGCGAAGAGAAGCTGAAGGAGCTGCA
GCAGAATGTCAATCACAACGGCGATAACTAGAGGGCTGGAGTTGGTCCGC
AATACAATATATGCCTGATATGATATTTTGATGTGCGAGAACGAGATAAT
CCGAGATAGAGGGAGAGAAGGCGAGGAAGAGAAGAGGAGGAAGCAGAAAT
AGCAAGGGGGGAGGAGGAGGAGGAGGAGGAGGATGATGATGATGATGACG
ATGACAAGGAGCATCAGCAGCATGCATATATAAACACATACATTAATTAA
TAACACTACGCTACATACCTATTATATACGAATGATATGTACTACATTAC
AAGAACGAAGATGGAACAACAGGCTGGCCTCTGTGTCTCTGTGTCAGTGT
CCAGTGTCAGTCAGCAAGCAACTTAACAACAAGCAACAAGCAACATGCAA
CACGCAACATCAGCAACAAAGCCAAGCAGCAATAATGCAACTATTCTAAC
TCTTTGCAACCAGAAAACATCCGCAACAGCAATGGAAAGTCTTTAAATGT
TAGTCCTTAAGCAGCGATAAACTTTAGTCTCGTGCATATGGCCAATATAT
ATAGTATATATATATATATGGTATATATATATATACGGTTATGTGCGCTT
CATTGTACAGCAGCTGTATGCACGCTGCTATTTGTTAGTTAAGTGATGGA
TATAAACCAACAAAACAAAACATAAGAGGAGGAAAGTTCTACCATTAAGG
TATAAATAGTAAACAAAAAACAAGTAAAACAAAACAAAAAAATGAAAACA
ATGCAAAACAAAAAAGAAAAAACTCGAAAAACAAAGCAAAAATCGAAAAC
AAAAACTTTTTGACAAAACGTTCAGCGTAGCAGGCAGGCAATTTATACAG
TTTATATAGGAAAAAAAAAAAAAAAA

RE23444.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 17:01:33
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16341642..16342638 814..1810 4970 99.9 Plus
chrX 22417052 chrX 16339599..16339903 37..341 1525 100 Plus
chrX 22417052 chrX 16340997..16341283 528..814 1435 100 Plus
chrX 22417052 chrX 16340037..16340225 341..529 945 100 Plus
chr3R 27901430 chr3R 26548986..26549160 67..241 350 80 Plus
chrX 22417052 chrX 16338408..16338444 2..38 185 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-RB 975 CG4429-PB 1..975 7..981 4875 100 Plus
Rbp2-RA 978 CG4429-PA 1..978 7..981 4810 99.7 Plus
Rbp2-RE 954 CG4429-PE 12..954 39..981 4715 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-RB 3895 CG4429-RB 29..1837 2..1810 9045 100 Plus
Rbp2-RA 3898 CG4429-RA 29..1840 2..1810 8980 99.8 Plus
Rbp2-RE 2816 CG4429-RE 344..2115 39..1810 8860 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-PB 324 CG4429-PB 1..324 7..978 1175 100 Plus
Rbp2-PA 325 CG4429-PA 1..325 7..978 1163 99.7 Plus
Rbp2-PE 317 CG4429-PE 5..317 40..978 1115 100 Plus
Rbp2-PC 358 CG4429-PC 1..358 7..978 851 70.9 Plus
Rbp2-PD 388 CG4429-PD 1..388 7..978 810 65.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16451918..16452930 814..1826 5035 99.8 Plus
X 23542271 X 16449875..16450179 37..341 1525 100 Plus
X 23542271 X 16451273..16451559 528..814 1435 100 Plus
X 23542271 X 16450313..16450501 341..529 945 100 Plus
3R 32079331 3R 30726475..30726649 67..241 350 80 Plus
X 23542271 X 16448693..16448729 2..38 185 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16460016..16461028 814..1826 5035 99.8 Plus
X 23527363 X 16457973..16458277 37..341 1525 100 Plus
X 23527363 X 16459371..16459657 528..814 1435 100 Plus
X 23527363 X 16458411..16458599 341..529 945 100 Plus
3R 31820162 3R 30467306..30467480 67..241 350 80 Plus
X 23527363 X 16456791..16456827 2..38 185 100 Plus
Blast to na_te.dros performed 2014-11-27 17:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 674..788 1600..1715 163 64.7 Plus

RE23444.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 18:03:01 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16340999..16341283 530..814 100 -> Plus
chrX 16340101..16340225 405..529 100 -> Plus
chrX 16339601..16339903 39..341 100 == Plus
chrX 16338406..16338444 1..38 97 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-31 13:00:59 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 1..975 7..981 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:44:07 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 1..975 7..981 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:03:01 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 1..975 7..981 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-31 13:00:58 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 15..1825 1..1810 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:44:07 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 27..1837 1..1810 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:03:01 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
Rbp2-RB 27..1837 1..1810 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 18:03:01 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
X 16451919..16452914 815..1810 100   Plus
X 16451275..16451559 530..814 100 -> Plus
X 16450314..16450501 342..529 100 -> Plus
X 16449877..16450179 39..341 100 -> Plus
X 16448691..16448729 1..38 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:44:07 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16345952..16346947 815..1810 100   Plus
arm_X 16345308..16345592 530..814 100 -> Plus
arm_X 16344347..16344534 342..529 100 -> Plus
arm_X 16343910..16344212 39..341 100 -> Plus
arm_X 16342724..16342762 1..38 97 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:56:31 Download gff for RE23444.complete
Subject Subject Range Query Range Percent Splice Strand
X 16460017..16461012 815..1810 100   Plus
X 16459373..16459657 530..814 100 -> Plus
X 16458412..16458599 342..529 100 -> Plus
X 16457975..16458277 39..341 100 -> Plus
X 16456789..16456827 1..38 97 -> Plus

RE23444.pep Sequence

Translation from 0 to 980

> RE23444.pep
KNMAGRGGYEHASGFGGDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIF
QDFEVKYVRLVKDRETDQFKGFCYVEFETLDNLERALECDGRIKLDDLSA
PLRIDIADRRKNDRPGGGVGGGNGGMTRGDGGRDGFQKRGPPRQGGSSQS
YSRGGPGTGGGGREGGGGSGNRGDSRDRPANRGRYGSFNNDDRPFERNQD
RDRGQREGSYGNQSRDGDRYNNFNRHRDRERTHYNPNQQSERPSGGMTGL
GGGSGGSGGLGVGGGSSMGAIDDNERPRLQLKPRTIAAPINAVAETKQSA
SIFGNAKPREEKLKELQQNVNHNGDN*

RE23444.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19517-PA 369 GF19517-PA 1..369 3..326 1109 76.5 Plus
Dana\GF22920-PA 526 GF22920-PA 77..164 24..111 394 78.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17966-PA 358 GG17966-PA 1..358 3..326 1275 89.1 Plus
Dere\GG11771-PA 495 GG11771-PA 62..150 23..111 402 78.7 Plus
Dere\GG11771-PA 495 GG11771-PA 342..446 220..311 203 47.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24789-PA 145 GH24789-PA 14..145 180..326 560 77.5 Plus
Dgri\GH22433-PA 113 GH22433-PA 1..113 3..114 526 89.4 Plus
Dgri\GH14211-PA 410 GH14211-PA 56..143 24..111 378 77.3 Plus
Dgri\GH14211-PA 410 GH14211-PA 302..395 205..319 173 40.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-PB 324 CG4429-PB 1..324 3..326 1741 100 Plus
Rbp2-PA 325 CG4429-PA 1..325 3..326 1729 99.7 Plus
Rbp2-PC 358 CG4429-PC 1..358 3..326 1685 90.5 Plus
Rbp2-PE 317 CG4429-PE 5..317 14..326 1681 100 Plus
Rbp2-PD 388 CG4429-PD 1..388 3..326 1644 83.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21487-PA 206 GI21487-PA 1..153 3..153 624 85.2 Plus
Dmoj\GI22119-PA 309 GI22119-PA 198..278 214..309 203 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20267-PA 300 GL20267-PA 1..285 3..325 1033 71.8 Plus
Dper\GL13513-PA 471 GL13513-PA 98..190 20..112 397 74.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18178-PB 335 GA18178-PB 1..334 3..325 1212 84.8 Plus
Dpse\GA18178-PA 368 GA18178-PA 1..367 3..325 1164 77.2 Plus
Dpse\GA12257-PB 471 GA12257-PB 98..190 20..112 397 74.2 Plus
Dpse\GA12257-PB 471 GA12257-PB 371..453 220..312 181 49.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13442-PA 358 GM13442-PA 1..358 3..326 1292 90.2 Plus
Dsec\GM12901-PA 502 GM12901-PA 354..458 220..311 195 48.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17286-PA 256 GD17286-PA 23..256 126..326 699 85.5 Plus
Dsim\GD21542-PA 472 GD21542-PA 324..428 220..311 200 47.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19028-PA 332 GJ19028-PA 1..332 3..326 1207 77.2 Plus
Dvir\GJ24240-PA 454 GJ24240-PA 41..129 23..111 381 75.3 Plus
Dvir\GJ24240-PA 454 GJ24240-PA 339..422 214..312 191 46.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25675-PA 354 GK25675-PA 1..352 3..325 1115 75.1 Plus
Dwil\GK14152-PA 461 GK14152-PA 71..160 22..111 398 76.7 Plus
Dwil\GK14152-PA 461 GK14152-PA 342..434 224..312 177 48.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17274-PA 358 GE17274-PA 1..358 3..326 1275 89.1 Plus
Dyak\GE10899-PA 502 GE10899-PA 74..162 23..111 400 78.7 Plus
Dyak\GE10899-PA 502 GE10899-PA 356..460 220..311 198 46.2 Plus

RE23444.hyp Sequence

Translation from 6 to 980

> RE23444.hyp
MAGRGGYEHASGFGGDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQD
FEVKYVRLVKDRETDQFKGFCYVEFETLDNLERALECDGRIKLDDLSAPL
RIDIADRRKNDRPGGGVGGGNGGMTRGDGGRDGFQKRGPPRQGGSSQSYS
RGGPGTGGGGREGGGGSGNRGDSRDRPANRGRYGSFNNDDRPFERNQDRD
RGQREGSYGNQSRDGDRYNNFNRHRDRERTHYNPNQQSERPSGGMTGLGG
GSGGSGGLGVGGGSSMGAIDDNERPRLQLKPRTIAAPINAVAETKQSASI
FGNAKPREEKLKELQQNVNHNGDN*

RE23444.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Rbp2-PB 324 CG4429-PB 1..324 1..324 1741 100 Plus
Rbp2-PA 325 CG4429-PA 1..325 1..324 1729 99.7 Plus
Rbp2-PC 358 CG4429-PC 1..358 1..324 1685 90.5 Plus
Rbp2-PE 317 CG4429-PE 5..317 12..324 1681 100 Plus
Rbp2-PD 388 CG4429-PD 1..388 1..324 1644 83.5 Plus