Clone RE24425 Report

Search the DGRC for RE24425

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:244
Well:25
Vector:pFlc-1
Associated Gene/TranscriptTrx-2-RA
Protein status:RE24425.pep: gold
Sequenced Size:733

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Trx-2-RA 2010-01-12 Manual selection by Sue Celniker

Clone Sequence Records

RE24425.complete Sequence

733 bp assembled on 2010-02-11

GenBank Submission: BT120324.1

> RE24425.complete
TGGGTAAAAAATTTAGCTGTGCTGCAAAGAGCTGCCCGAGTGGTAATTAA
GTAACTTTTGTACATTTCTACCGGTTCCGTCTCCACATCTCCCATCCAAC
ATGGTGTACCAGGTGAAAGATAAGGCCGATCTCGATGGACAGCTGACCAA
GGCATCCGGCAAGCTGGTGGTGCTGGATTTCTTCGCCACTTGGTGCGGAC
CCTGCAAGATGATCTCGCCCAAACTGGTTGAGCTTTCCACGCAGTTCGCC
GACAACGTCGTCGTCCTGAAGGTCGATGTGGACGAATGCGAAGACATTGC
AATGGAATACAACATCTCCAGCATGCCCACCTTCGTGTTCCTCAAGAACG
GCGTCAAGGTCGAAGAGTTCGCCGGAGCCAACGCCAAGCGTCTGGAGGAT
GTCATCAAGGCCAATATCTAAGTGGGCAGCGCATAGACGTCTGGCCGTCC
CCCTGATCCACCTATGAGTTTTCTTCATAACATTTAGTTAATTAATTAAT
TCCATAAGTGCAGGGTTTTGCTCCATTCCGCCTGCTCCGCCTTGTCCTTG
AATCCCTTAGAGCTGCAGTGCAGTTCGCAAGGTGAAGGTCAGCAGTGGCA
GCAGTTGGAACAGCAACAAACGTGAGAAACTAAGTGGCTTTTAAACGTAA
AATTTGCTTTGTTAACAAAATCAATAAATCACACAAAGATTGTTCATTTT
TGTATGAAAAACATTGGAAAAAAAAAAAAAAAA

RE24425.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-RA 1303 Trx-2-RA 236..954 3..721 3580 99.8 Plus
Trx-2-RB 1277 Trx-2-RB 224..928 17..721 3510 99.8 Plus
Trx-2.a 741 Trx-2.a 70..666 125..721 2970 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9614344..9614789 270..715 2200 99.6 Plus
chr2L 23010047 chr2L 9614108..9614258 123..273 710 98 Plus
chr2L 23010047 chr2L 9612245..9612367 3..125 615 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-RA 321 CG31884-PA 1..321 101..421 1605 100 Plus
Trx-2-RB 321 CG31884-PB 1..321 101..421 1605 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:54 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-RA 790 CG31884-RA 6..718 3..715 3565 100 Plus
Trx-2-RB 1338 CG31884-RB 211..909 17..715 3495 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-PA 106 CG31884-PA 1..106 101..418 541 100 Plus
Trx-2-PB 106 CG31884-PB 1..106 101..418 541 100 Plus
TrxT-PB 157 CG3315-PB 1..103 101..409 324 59.2 Plus
TrxT-PA 157 CG3315-PA 1..103 101..409 324 59.2 Plus
CG13473-PA 139 CG13473-PA 26..110 155..409 239 45.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9615530..9615981 270..721 2245 99.8 Plus
2L 23513712 2L 9615300..9615450 123..273 755 100 Plus
2L 23513712 2L 9613419..9613541 3..125 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9615530..9615981 270..721 2245 99.7 Plus
2L 23513712 2L 9615300..9615450 123..273 755 100 Plus
2L 23513712 2L 9613419..9613541 3..125 615 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:44:41 has no hits.

RE24425.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:41:57 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9614346..9614791 272..717 99   Plus
chr2L 9614110..9614256 125..271 97 -> Plus
chr2L 9612243..9612366 1..124 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 16:55:52 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RA 1..321 101..421 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:25:43 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RA 1..321 101..421 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:40:10 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 1..321 101..421 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:57 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RB 1..321 101..421 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 16:55:50 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RA 39..755 1..717 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:25:43 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RA 39..755 1..717 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:40:10 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RA 4..720 1..717 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:57 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
Trx-2-RA 4..720 1..717 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:41:57 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9615532..9615977 272..717 99   Plus
2L 9615302..9615448 125..271 100 -> Plus
2L 9613417..9613540 1..124 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:40:10 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9615532..9615977 272..717 99   Plus
arm_2L 9615302..9615448 125..271 100 -> Plus
arm_2L 9613417..9613540 1..124 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:30 Download gff for RE24425.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9615532..9615977 272..717 99   Plus
2L 9615302..9615448 125..271 100 -> Plus
2L 9613417..9613540 1..124 99 -> Plus

RE24425.pep Sequence

Translation from 100 to 420

> RE24425.pep
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA
DNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLED
VIKANI*

RE24425.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Trx-2-PA 106 GF22780-PA 1..106 1..106 494 86.8 Plus
Dana\TrxT-PA 177 GF20950-PA 1..98 1..98 320 60.2 Plus
Dana\GF24615-PA 119 GF24615-PA 9..86 21..98 231 44.9 Plus
Dana\GF23991-PA 287 GF23991-PA 6..106 5..106 222 40.2 Plus
Dana\GF24914-PA 143 GF24914-PA 34..132 2..104 196 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Trx-2-PA 106 GG10043-PA 1..106 1..106 505 88.7 Plus
Dere\TrxT-PA 149 GG18503-PA 1..98 1..98 311 57.1 Plus
Dere\dhd-PA 107 GG18749-PA 3..101 4..102 227 38.4 Plus
Dere\GG15284-PA 287 GG15284-PA 6..103 5..103 222 40.4 Plus
Dere\GG15694-PA 135 GG15694-PA 30..105 23..98 218 46.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\Trx-2-PA 106 GH10676-PA 1..103 1..103 411 74.8 Plus
Dgri\TrxT-PA 166 GH24365-PA 1..98 1..98 275 50 Plus
Dgri\GH14756-PA 133 GH14756-PA 14..115 2..103 269 44.1 Plus
Dgri\GH15527-PA 287 GH15527-PA 6..106 5..106 229 40.2 Plus
Dgri\dhd-PA 106 GH24609-PA 3..101 4..102 210 38.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-PA 106 CG31884-PA 1..106 1..106 541 100 Plus
Trx-2-PB 106 CG31884-PB 1..106 1..106 541 100 Plus
TrxT-PB 157 CG3315-PB 1..103 1..103 324 59.2 Plus
TrxT-PA 157 CG3315-PA 1..103 1..103 324 59.2 Plus
CG13473-PA 139 CG13473-PA 26..110 19..103 239 45.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Trx-2-PA 106 GI11084-PA 1..103 1..103 406 71.8 Plus
Dmoj\TrxT-PA 165 GI11058-PA 1..98 1..98 303 56.1 Plus
Dmoj\GI11498-PA 162 GI11498-PA 14..115 2..103 276 45.1 Plus
Dmoj\GI14472-PA 106 GI14472-PA 4..101 5..102 214 37.8 Plus
Dmoj\dhd-PA 106 GI11071-PA 4..101 5..102 212 37.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\TrxT-PA 167 GL14330-PA 1..98 1..98 317 58.2 Plus
Dper\GL24554-PA 141 GL24554-PA 11..110 5..103 264 43 Plus
Dper\GL16306-PA 287 GL16306-PA 6..106 5..106 232 42.2 Plus
Dper\Trx-2-PA 106 GL18920-PA 1..49 1..53 210 71.7 Plus
Dper\dhd-PA 106 GL14288-PA 4..97 5..98 209 37.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Trx-2-PA 106 GA16546-PA 1..106 1..106 469 82.1 Plus
Dpse\TrxT-PA 167 GA17324-PA 1..98 1..98 314 57.1 Plus
Dpse\GA12311-PA 141 GA12311-PA 11..110 5..103 264 43 Plus
Dpse\GA18927-PA 287 GA18927-PA 6..106 5..106 232 42.2 Plus
Dpse\dhd-PA 106 GA18018-PA 4..97 5..98 209 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Trx-2-PA 106 GM17580-PA 1..106 1..106 543 98.1 Plus
Dsec\TrxT-PA 172 GM12651-PA 1..98 1..98 318 61.2 Plus
Dsec\GM25478-PA 139 GM25478-PA 25..105 18..98 244 49.4 Plus
Dsec\dhd-PA 107 GM12398-PA 4..101 5..102 236 40.8 Plus
Dsec\GM14718-PA 287 GM14718-PA 6..106 5..106 222 39.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Trx-2-PA 106 GD23618-PA 1..106 1..106 543 98.1 Plus
Dsim\GD14500-PA 139 GD14500-PA 25..105 18..98 244 49.4 Plus
Dsim\GD11480-PA 145 GD11480-PA 31..120 2..92 171 33 Plus
Dsim\GD13682-PA 142 GD13682-PA 34..132 2..104 167 35 Plus
Dsim\GD16424-PA 159 GD16424-PA 52..148 5..102 135 29.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Trx-2-PA 106 GJ18315-PA 1..103 1..103 410 74.8 Plus
Dvir\TrxT-PA 163 GJ16575-PA 1..98 1..98 303 55.1 Plus
Dvir\GJ13693-PA 162 GJ13693-PA 14..115 2..103 264 43.1 Plus
Dvir\GJ12550-PA 287 GJ12550-PA 6..106 5..106 225 40.2 Plus
Dvir\dhd-PA 106 GJ16851-PA 9..97 10..98 209 40.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Trx-2-PA 106 GK23868-PA 1..106 1..106 475 83 Plus
Dwil\TrxT-PA 174 GK25104-PA 1..98 1..98 328 60.2 Plus
Dwil\GK10532-PA 176 GK10532-PA 12..110 5..103 271 42.4 Plus
Dwil\GK17306-PA 287 GK17306-PA 6..106 5..106 242 41.2 Plus
Dwil\dhd1-PA 108 GK25840-PA 11..99 10..98 231 47.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Trx-2-PA 106 GE18857-PA 1..106 1..106 468 93.4 Plus
Dyak\TrxT-PA 157 GE16820-PA 1..98 1..98 349 64.3 Plus
Dyak\dhd-PA 107 GE16391-PA 3..101 4..102 232 39.4 Plus
Dyak\GE22025-PA 132 GE22025-PA 25..110 18..103 230 43 Plus
Dyak\GE21506-PA 287 GE21506-PA 6..106 5..106 225 40.2 Plus

RE24425.hyp Sequence

Translation from 100 to 420

> RE24425.hyp
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA
DNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLED
VIKANI*

RE24425.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:25:09
Subject Length Description Subject Range Query Range Score Percent Strand
Trx-2-PA 106 CG31884-PA 1..106 1..106 541 100 Plus
Trx-2-PB 106 CG31884-PB 1..106 1..106 541 100 Plus
TrxT-PB 157 CG3315-PB 1..103 1..103 324 59.2 Plus
TrxT-PA 157 CG3315-PA 1..103 1..103 324 59.2 Plus
CG13473-PA 139 CG13473-PA 26..110 19..103 239 45.9 Plus