Clone RE24850 Report

Search the DGRC for RE24850

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:248
Well:50
Vector:pFlc-1
Associated Gene/TranscriptInx7-RA
Protein status:RE24850.pep: gold
Sequenced Size:1643

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
inx7-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE24850.complete Sequence

1643 bp assembled on 2009-08-06

GenBank Submission: BT099510.1

> RE24850.complete
AGTTACGAGGAGCTAGCCGCGGCAAGCGGAGCGCACAAATCCATCCGAAC
CCAGAAGCCAGCCCGTTTCCAATTGCCACCCAGCCATAGTTGTCGTAATC
ATCGTAAGAAAGTGAACGAAGTAGAAGTGGGATCGGATCGGATCGGATCG
GGGCCAGAACCTAACCCAAAACCGAAGATAACGAAGGCGTTACAATGCTG
AACACCTTCAGTTCGGTGAGGCAGTACCTCAAGTTCGATCTCACGCGTGT
GGTCATCGACAATATAGTGTTCAAGCTGCACTATCGATGGACCTTCGTAA
TACTCCTAGTGGCCACCCTCCTGATCACGTCGCGCCAGTACATCGGGGAG
CACATCCAGTGCCTATCCGACGGTGTTGTGTCTCCGGTCATCAACACCTT
CTGCTTCTTCACGCCCACCTTCACAGTGGTACGTGACCAGAACCAAACTG
CCTACAGGCCGGGAAGTGAGCCACCTGGTATAGGGGCATTCGATCCCGAA
AAGGACACGATCAAGCGGCATGCATACTACCAGTGGGTGCCCTTTGTCCT
GTTCTTCCAGGCTCTCTGCTTCTACATTCCCCATGCCCTGTGGAAGAGTT
GGGAGGGCGGCCGGATCAAGGCCCTGGTCTTTGGTCTTCGAATGGTGGGT
CTAACGAGGTACCTGAAGAACGATAGTCTGCGTATCGGCAAGCTGAACAT
TCCCTCGATGGCGGAGGCGGAGGAGCGGGTCAAGGACATTCGTCGCACAA
TGATCGACCGGATGCGGCTGAATCAATCGTGGGGTGCCCACTTGGTCTTC
GCGGAGGTGCTCAATCTGATTAATCTTCTGCTGCAGATCACATGGACCAA
CCGTTTTTTGGGCGGTCAATTCCTCACACTGGGACCACATGCCCTGAAAA
ATCGGTGGTCCGACGAGCTGAGCGTTTTGGATCTAGTATTCCCGAAGATT
ACCAAGTGCAAGTTCCACAAATTTGGTGACTCTGGCTCCATTCAAATGCA
CGATGCCCTTTGCGTGATGGCGCTGAACATCATGAACGAGAAGATCTACA
TTATTCTGTGGTTCTGGTACGCCTTCCTTTTGATTGTTACTGTTCTGGGA
CTGCTTTGGAGAATTTTAACCCTGTGCTTCTACAGAAATGTCACATTTAC
CCGCTGGTCTCTCTATTGGGCCAAGCCTGGCCAACTGGACGAAAACGAAT
TATTGGCGGTAATTGATAAGTGTAACTTTTCCAACTGGATGTTCCTTTTC
TTCCTGCGCTCCAACCTTTCGGAGTTCCTATTCAAGAAGGTTATCTATCA
TTTGGCTAGTGAGTTCCCCAATCCCGATCACGATAACGATGTCAATGCCT
ATCGAGAGGCACCGCCCACGCCCGCTAAGAACCGTTATCCGGAGCTCAGT
GGTCTGGATACGATTGATTCACCACTCTTGCACCTTCGACGCAATGGCTC
GCCCTCTGCCGGCGGAGCCCAAGGGCCATCGACTTCGGATATGGCAAAGT
TACCTGTATAATTTATGCATTTCAATTAACGCTAGGCAATTAATTATTGG
AGCTTTGTCTTGTTTACACCTGTTTTTTTTTTATATATATATATGATCAT
TTCATTATAAATATATTTATTATTAAGAAAAAAAAAAAAAAAA

RE24850.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
inx7-RA 1933 inx7-RA 303..1930 1..1628 8125 99.9 Plus
inx7-RB 1690 inx7-RB 488..1689 427..1628 5995 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6884279..6884989 1138..428 3540 99.9 Minus
chrX 22417052 chrX 6883720..6884208 1627..1139 2445 100 Minus
chrX 22417052 chrX 6885283..6885713 431..1 2155 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-RA 1317 CG2977-PA 1..1317 195..1511 6570 99.9 Plus
Inx7-RB 1086 CG2977-PB 2..1086 427..1511 5410 99.9 Plus
Inx3-RC 1188 CG1448-PC 724..841 951..1068 185 77.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-RA 1634 CG2977-RA 6..1632 1..1627 8120 99.9 Plus
Inx7-RB 1690 CG2977-RB 488..1688 427..1627 5990 99.9 Plus
Inx3-RC 1652 CG1448-RC 864..981 951..1068 185 77.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-PA 438 CG2977-PA 1..438 195..1508 2183 100 Plus
Inx7-PB 361 CG2977-PB 1..361 426..1508 1850 99.7 Plus
Inx2-PD 367 CG4590-PD 1..358 195..1331 634 38.5 Plus
Inx2-PC 367 CG4590-PC 1..358 195..1331 634 38.5 Plus
Inx2-PB 367 CG4590-PB 1..358 195..1331 634 38.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6992173..6992883 1138..428 3540 99.9 Minus
X 23542271 X 6991613..6992102 1628..1139 2450 100 Minus
X 23542271 X 6993177..6993607 431..1 2155 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7000271..7000981 1138..428 3540 99.8 Minus
X 23527363 X 6999711..7000200 1628..1139 2450 100 Minus
X 23527363 X 7001275..7001705 431..1 2155 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:49:48 has no hits.

RE24850.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:57:49 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6885286..6885713 1..428 100   Minus
chrX 6884279..6884988 429..1138 99 <- Minus
chrX 6883720..6884208 1139..1627 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:06 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
inx7-RA 1..1317 195..1511 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:03 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
inx7-RA 1..1317 195..1511 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:07 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
Inx7-RA 1..1317 195..1511 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:49 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
Inx7-RA 1..1317 195..1511 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-06 18:38:00 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
inx7-RA 1..1627 1..1627 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:03 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
inx7-RA 1..1627 1..1627 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:07 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
Inx7-RA 6..1632 1..1627 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:49 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
Inx7-RA 6..1632 1..1627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:57:49 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
X 6993180..6993607 1..428 100   Minus
X 6992173..6992882 429..1138 99 <- Minus
X 6991614..6992102 1139..1627 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:07 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6887213..6887640 1..428 100   Minus
arm_X 6886206..6886915 429..1138 99 <- Minus
arm_X 6885647..6886135 1139..1627 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:36 Download gff for RE24850.complete
Subject Subject Range Query Range Percent Splice Strand
X 7001278..7001705 1..428 100   Minus
X 7000271..7000980 429..1138 99 <- Minus
X 6999712..7000200 1139..1627 100 <- Minus

RE24850.pep Sequence

Translation from 194 to 1510

> RE24850.pep
MLNTFSSVRQYLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYI
GEHIQCLSDGVVSPVINTFCFFTPTFTVVRDQNQTAYRPGSEPPGIGAFD
PEKDTIKRHAYYQWVPFVLFFQALCFYIPHALWKSWEGGRIKALVFGLRM
VGLTRYLKNDSLRIGKLNIPSMAEAEERVKDIRRTMIDRMRLNQSWGAHL
VFAEVLNLINLLLQITWTNRFLGGQFLTLGPHALKNRWSDELSVLDLVFP
KITKCKFHKFGDSGSIQMHDALCVMALNIMNEKIYIILWFWYAFLLIVTV
LGLLWRILTLCFYRNVTFTRWSLYWAKPGQLDENELLAVIDKCNFSNWMF
LFFLRSNLSEFLFKKVIYHLASEFPNPDHDNDVNAYREAPPTPAKNRYPE
LSGLDTIDSPLLHLRRNGSPSAGGAQGPSTSDMAKLPV*

RE24850.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20329-PA 440 GF20329-PA 1..440 1..438 1896 81.2 Plus
Dana\GF20357-PA 367 GF20357-PA 1..358 1..379 642 37.7 Plus
Dana\GF17986-PA 395 GF17986-PA 16..357 12..372 578 35.1 Plus
Dana\GF20330-PA 362 GF20330-PA 1..359 1..380 531 32.3 Plus
Dana\GF16006-PA 435 GF16006-PA 37..360 1..307 366 29.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17644-PA 444 GG17644-PA 1..444 1..438 2110 92.1 Plus
Dere\GG19626-PA 367 GG19626-PA 1..358 1..379 664 38.5 Plus
Dere\GG12050-PA 394 GG12050-PA 8..385 6..396 573 33.8 Plus
Dere\GG17574-PA 372 GG17574-PA 1..359 1..379 535 33.8 Plus
Dere\GG17645-PA 362 GG17645-PA 1..359 1..380 512 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24273-PA 441 GH24273-PA 1..434 1..435 1612 72.8 Plus
Dgri\GH24686-PA 367 GH24686-PA 1..352 1..373 646 37.8 Plus
Dgri\GH19243-PA 394 GH19243-PA 8..357 6..372 587 35.9 Plus
Dgri\GH17771-PA 480 GH17771-PA 109..467 1..379 539 33.5 Plus
Dgri\GH24274-PA 362 GH24274-PA 1..360 1..381 515 30.9 Plus
Dgri\GH17771-PA 480 GH17771-PA 1..110 16..124 180 38.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-PA 438 CG2977-PA 1..438 1..438 2339 100 Plus
Inx7-PB 361 CG2977-PB 1..361 78..438 1936 99.7 Plus
Inx2-PD 367 CG4590-PD 1..358 1..379 675 38.5 Plus
Inx2-PC 367 CG4590-PC 1..358 1..379 675 38.5 Plus
Inx2-PB 367 CG4590-PB 1..358 1..379 675 38.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21580-PA 441 GI21580-PA 1..441 1..438 1621 72.9 Plus
Dmoj\GI21669-PA 367 GI21669-PA 1..352 1..373 636 38.2 Plus
Dmoj\GI24278-PA 394 GI24278-PA 8..385 6..395 585 33.4 Plus
Dmoj\GI15107-PA 372 GI15107-PA 1..359 1..379 541 33.8 Plus
Dmoj\GI21582-PA 362 GI21582-PA 1..361 1..382 528 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26810-PA 432 GL26810-PA 1..432 1..438 1766 79.5 Plus
Dper\GL23353-PA 395 GL23353-PA 16..358 12..373 557 33.6 Plus
Dper\GL26811-PA 362 GL26811-PA 1..359 1..380 515 31.9 Plus
Dper\GL26820-PA 303 GL26820-PA 1..294 1..379 435 32.2 Plus
Dper\GL13242-PA 368 GL13242-PA 1..361 1..379 388 28.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:24:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15552-PA 432 GA15552-PA 1..432 1..438 1761 79.5 Plus
Dpse\GA18281-PA 367 GA18281-PA 1..358 1..379 650 38 Plus
Dpse\GA13015-PA 395 GA13015-PA 16..358 12..373 559 33.6 Plus
Dpse\GA25656-PA 372 GA25656-PA 1..359 1..379 540 33.5 Plus
Dpse\GA26182-PA 362 GA26182-PA 1..359 1..380 515 31.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17485-PA 434 GM17485-PA 1..434 1..438 2107 94.5 Plus
Dsec\GM17498-PA 367 GM17498-PA 1..358 1..379 656 38.2 Plus
Dsec\GM12279-PA 395 GM12279-PA 8..357 6..372 575 33.5 Plus
Dsec\GM22657-PA 372 GM22657-PA 1..359 1..379 535 33.8 Plus
Dsec\GM17487-PA 362 GM17487-PA 1..359 1..380 503 31 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16170-PA 434 GD16170-PA 1..434 1..438 2115 95 Plus
Dsim\GD18012-PA 395 GD18012-PA 8..357 6..372 577 33.8 Plus
Dsim\GD16826-PA 347 GD16826-PA 1..338 1..379 542 34.8 Plus
Dsim\GD16171-PA 362 GD16171-PA 1..359 1..380 503 31 Plus
Dsim\GD15600-PA 397 GD15600-PA 1..383 1..372 381 27.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15802-PA 440 GJ15802-PA 1..440 1..438 1577 73.1 Plus
Dvir\GJ15793-PA 367 GJ15793-PA 1..352 1..373 641 38.3 Plus
Dvir\GJ18913-PA 372 GJ18913-PA 1..359 1..379 541 33.8 Plus
Dvir\GJ23057-PA 381 GJ23057-PA 8..298 6..310 541 37.3 Plus
Dvir\GJ15803-PA 362 GJ15803-PA 1..359 1..380 535 33.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25295-PA 439 GK25295-PA 1..439 1..438 1665 75.1 Plus
Dwil\GK25636-PA 367 GK25636-PA 1..353 1..374 649 38.5 Plus
Dwil\GK13974-PA 395 GK13974-PA 8..388 6..398 574 33.7 Plus
Dwil\GK20049-PA 372 GK20049-PA 1..359 1..379 535 33.8 Plus
Dwil\GK25296-PA 362 GK25296-PA 1..359 1..380 531 32.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17551-PA 444 GE17551-PA 1..444 1..438 2100 92.3 Plus
Dyak\GE15694-PA 367 GE15694-PA 1..358 1..379 662 38.5 Plus
Dyak\GE10490-PA 395 GE10490-PA 8..386 6..396 574 32.8 Plus
Dyak\GE15333-PA 372 GE15333-PA 1..359 1..379 535 33.8 Plus
Dyak\GE17553-PA 362 GE17553-PA 1..359 1..380 494 31.1 Plus

RE24850.hyp Sequence

Translation from 194 to 1510

> RE24850.hyp
MLNTFSSVRQYLKFDLTRVVIDNIVFKLHYRWTFVILLVATLLITSRQYI
GEHIQCLSDGVVSPVINTFCFFTPTFTVVRDQNQTAYRPGSEPPGIGAFD
PEKDTIKRHAYYQWVPFVLFFQALCFYIPHALWKSWEGGRIKALVFGLRM
VGLTRYLKNDSLRIGKLNIPSMAEAEERVKDIRRTMIDRMRLNQSWGAHL
VFAEVLNLINLLLQITWTNRFLGGQFLTLGPHALKNRWSDELSVLDLVFP
KITKCKFHKFGDSGSIQMHDALCVMALNIMNEKIYIILWFWYAFLLIVTV
LGLLWRILTLCFYRNVTFTRWSLYWAKPGQLDENELLAVIDKCNFSNWMF
LFFLRSNLSEFLFKKVIYHLASEFPNPDHDNDVNAYREAPPTPAKNRYPE
LSGLDTIDSPLLHLRRNGSPSAGGAQGPSTSDMAKLPV*

RE24850.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Inx7-PA 438 CG2977-PA 1..438 1..438 2339 100 Plus
Inx7-PB 361 CG2977-PB 1..361 78..438 1936 99.7 Plus
Inx2-PD 367 CG4590-PD 1..358 1..379 675 38.5 Plus
Inx2-PC 367 CG4590-PC 1..358 1..379 675 38.5 Plus
Inx2-PB 367 CG4590-PB 1..358 1..379 675 38.5 Plus