Clone RE26467 Report

Search the DGRC for RE26467

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:264
Well:67
Vector:pFlc-1
Associated Gene/Transcripttara-RB
Protein status:RE26467.pep: gold
Sequenced Size:4083

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
tara-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE26467.complete Sequence

4083 bp assembled on 2009-08-19

GenBank Submission: BT099632.1

> RE26467.complete
CTTTGTGATTTTAGCACGGCGCTGCGAGGTCCACGTCGCTCATTTGCTCC
GTGCCCGCTCGACAGCTCCAATTCGAAAACGACGTAAACGCCAGCCGTTC
GCCAAGCGCGCGTAATTCAAAGTTATCAACTCGAAACACTGTTTCCCGGA
AAAAGTGCACACCGTTAAATGTGAAATATTCAATCAAGTCAACTGGAGAA
TATAAAAAAATATTAAAAAAAATTAAAGTGAACTGCATTATACACAGATT
GATCAGTTTAAGTAGTGCCAGCCATGTCGTCCAAGTTCTGTGATGCCGCT
TTGGGTCGCTCCTACGCCTGTTCGTCCCGCTTTCCTTCGGGACACCTGCT
GGCCACCCTCTGATCCGCCCACGCCGCCCAGTGACTGACTGAAAGGGATC
GTACCGCCCTGAACAAAAACTCCAACGCGTTACCTTTTTTTTCGTTTCCC
ATCTATTTGGCTATAAACGTTGTGAAACTGGGAACGGCCCAGCCGAAAAT
GTGCACTGAGGTGAATTCCGCGATGGGTCTTCAAGCAACAGCCGCCACCA
AGCGGAAGCATGAGCTGACCTTCGACAGCAAGGATGCCAACACCACCTAC
ACGGGCAACTGTGCCCCGCCCCCCGTCAAGGCCAACAAGTGGGCCATCAG
CAACAACAACTACCTGGAGTCGCTCGAGGAGCAGCAGCAGCAACAGCAAT
CGCCATCGGAGCCAGCTGTTGAGTCCAACAACAACCACATTGTTTTAGAA
GCATCAATGGATGCGTTGAAGCCAACGGAGCCAAGTATTAGCAATGGTCA
TGAAGTTACTACCGCCGTCGCAGCAATGAAAAGTCAAGCGGAGGTGCCAC
TCCCGCCAACAGCGAGTGCGGCGATACCGGAGGACAGTATCGCCAGGTTA
GAGGTGGTCACCTCAGCCGTTCCTTGTGAGCCCTGGACGAGCAATGGGCC
CACTACTCCTTCCGCGGTGGCAGGACCCGCAGCATCCGCGGAACCTGTGG
ATTGCATCTCCAAGCTGCAGGCCGTCGCGGTGCCCAGTGATCCTTGGGGT
AGCATTGCCACCCGCTCCACTCTGGCAACGACTTTGCTCAGTGCCGATGA
GCTGGACGACGATGATGATGATTTTGAGGACGACTACGAGGAGGAGGAGA
GCATCATACCCACCTACTGTCCCATGCGCTATCATCCCTTTGTACCGCAT
CCGCACCCTCATTCGCACCAGCTGCCGTCCCATCCCCACCAGCAGCAGCC
GCAGCAGCTCTCCCAACAACAACCACATCCCCAGCAGCAGCAACTCGCCC
AGCAGCAGCAACAACATCCGCAGCAGCAGCGAAGCTATGCCCCCGGATAT
GGGAGCAGGCAACCCAACTACTATTCGGAGCCTTTCCCGCAGCAGAATTG
CTCGCGGACAGGAGGACCGCAGCACATGACGCAATCACCGCCAACACCGC
AGCAGGCGCGTGGTTTCGCTCCACCCCAGTGGGCGACAGCGGGTAGCAGT
CCGGCCAATCCCTCATCGGGAGCCCAACAGTTCTACGAGCCGACCAACGG
TGGAGCTTATGCCCCGCCAGCGGCGCCCCAGCAGACAATTCGTTGTGCAG
AGAACGGCAAATCCTATCTGGACCTGGGCTGCAGCAGTGGCGCATCCGGA
AATGCTGGAGGATCGCCCATCAGTCCGCCGCCCTCATCAGCGCCTGTTGT
TCCATTCGCCGGCTTGCCTCTCCATGGCCTGCCTCTTAAAAGGTGCTGCG
ATGGACGACCCGGTGGCTGGTGCAGTGCCAACAGGAGTTGCTACAAGGAC
ACGCGCCTGAAGATACGCAATCTGTCCATGTTCAAACTCTCCCGTTTCCG
GCAGGTTTCTGAGCAGTCGCTGTACCGCTCGGTGCTCATTTGCAATACGC
TGAAGCGCATTGATCGGGAGATCGAAGCAGAGGCCAAGGAGCTGCACCAG
GCGGCGCAACAGCACCACCAACAGGCGGCAGCAGCAGCAGCCGCAGCAGC
AGCAGCGGCGGCACAAGCGGCTCAGTACCACCCAGCCTACCAGCAGCAGC
AGCAGCAGCAGCAATCCCCGCCAGCACCTCTGCATCCACATACGCAGCAG
CAGATGGACTATGCGCCCGTGTTGAACTGTGCTCGTTTGGCCAACATGGA
TCACTACCAGCAACTCAGTTTCCAGCCCCAACACCAGCAGCAACAGCAGC
CTTCGCAGCCGCATAGCTACCACGAGCGTCTGGACAGCCAACCCGCCTAC
AGGGGCGCGGCAGCGGGTGCGGGCAGCTTCGCCACGCAGCCGAGCAACTG
TGATACATCAGCGGGTGCAAGTAGCAGCAATACCAGCGGCAACAGCAACA
ACTCCTCAGCGACGGCGGCGAGCAGCAACAGTAGTTTGCACCCCTACGAT
CACTATCCCTTTCGGGAGTCGCAATCTGGTCGAGCAACGCCCTTTCCGGC
CTGCCCCACCACAACAGCAGCAGCGGCAGCAGCTTCGGCAGCAGCCGCAG
CTTCCAGTGGAGGAGCAGCAACAACACTAAGTAGCAACATCAGCAGCTCC
CCCGCATCAAGCAGCACTAGCAGCAACACCACTTCCTCAACGGTGATCAG
CAGCAGTAGTGGGAATACCGTGAGCAGCAACGGCACCACGCCAGTTGCAC
CTACCGCAAGCAGCAGCAACTGCGATACTAGCGATTCGGGTTATGCGGAC
GACGACTCCACGCGATCCATCAACTGGAGTTCGGTGCTGAGCCTCAGTTC
GCAATCGGCGTTGGATCCGCTCAACAACAACGATTTGTTTAGCATACTTC
CGTCGGCGGCCACACCTACAGCGGTGCCAGTTTCAGTGCCAGCCAGTAGT
TCCAGTTCCTCCTCGGGGTCCACGCTGGCATTCAGTGGAAGCTTCACCAC
CGTACAAGCCAGCGGCGGCAGTAGCAGTTCCTGCGGAAGCAGCTCCACCA
CCGCCACATTCACCACCCTGTCGACCATCTCCTCGGCCACCCACTCGCTG
ACCTCGTCGTATGTAAGCAGCATTAGCTCCAATGTGTCGGCGGGCGCCAA
TACCTGGGAGTACGGATTCCTGGACATGGAATTCGGACTCGGTTCGGAGT
TCACGGAGCTGGTACCCAGCTGTAAGCTCAGCTCCGAGGATCTGTTCAAG
AGCGGATTGGGCGGTCAGGTTGTGACCGCCTCCCGCCTGCACGACAACGA
ACTGGAGCACCCGGCCCACATCATGGTCGGTAGTTAGTATCAGTTGTAGA
CGATGACGGCGACGGATCCCCAGCGGATGGCGGCGTGCTGGTCGCGTCGC
CTGCTGGCGCCCACTAGCAATTCCAAGCAGTATTGAATCGACGAAATGGG
GGAGGGGCTGAGGGGATGTTAAATGCTAATTGTGCTCAGGTTGTGAACGT
GCATGAGAATATAAATATATACATATATTCGAAAGTCTTGGTCCTAAATA
CCCCTCTCCCCCTTCCTTCACACAAGCAATCGGGGACACAAATTAATTGC
AATCTTTAATGAAATTCTTAAGAGAGATCGAAGAAATGGCAGAACAATGA
ATATGACAAATGAGCAAGCAAAACTATTAGCAAATTTTTCTAAGTGTAAA
TATTATTAGTTTTAAGGCAAAACAGCGAACTCCTAGCCAAGTAAGTTTGA
AACGGAAGCAAAACAAAATTCTATATTAGCGTAACTTTAGCATTGTTAGT
TGCAATTGTTGCAGTTTTTCGATTCAACACCACACAAGAACAACAACAGC
ATCAAATCGAACAACAAAAGGCCGTTGGAAATTTTTCAAAACCCAAATCA
ATTAACAAAATTTACGTTTACGTTACGTTTACGTTGGCCTAAAGACGATG
CAGCATTTGGCTTGCAAGGAGAAATTGATGAAAAATCGAAAAACGTTTAC
TATATTACTAGCCATAAGTATTATTATTTATATACAAAACCGCAGAAAAC
AAACAAACAAAAGAACAACTTAAAACAAAGTTTTATAAAAGAAAAAACAA
CCGAAAAAAAACACAAAAATAACAAAAAAATTAAAAACGCAAGCAAATAT
AAAGAATTTGTTAAAAGAAAAAAAAAAAAAAAA

RE26467.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
tara-RB 4155 tara-RB 88..4152 2..4066 20325 100 Plus
tara-RA 4328 tara-RA 792..4328 511..4047 17685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12081414..12084971 509..4066 17745 99.9 Plus
chr3R 27901430 chr3R 12067457..12067969 2..514 2565 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
tara-RB 2739 CG6889-PB 1..2739 499..3237 13695 100 Plus
tara-RA 2751 CG6889-PA 25..2751 511..3237 13635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
tara-RB 4066 CG6889-RB 6..4066 2..4062 20305 100 Plus
tara-RA 4341 CG6889-RA 790..4341 511..4062 17760 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
tara-PB 912 CG6889-PB 1..766 499..2796 2091 100 Plus
tara-PA 916 CG6889-PA 2..770 496..2796 2072 99.6 Plus
tara-PB 912 CG6889-PB 849..912 3043..3234 339 100 Plus
tara-PA 916 CG6889-PA 853..916 3043..3234 339 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16256776..16260339 509..4072 17805 100 Plus
3R 32079331 3R 16242821..16243333 2..514 2565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15997607..16001170 509..4072 17805 99.9 Plus
3R 31820162 3R 15983652..15984164 2..514 2565 100 Plus
Blast to na_te.dros performed 2014-11-27 12:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2292..3014 1930..2687 381 56 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2401..2982 1940..2547 377 56.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2552 2451..2686 322 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6749..6926 2459..2640 298 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2664 2320..2670 293 58.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6725..7112 2173..2577 243 57.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6719..6995 2316..2591 240 59.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..6872 2530..2682 226 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2685 2173..2565 218 56.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6730..7007 2305..2577 208 58.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..7028 2273..2591 202 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2352..2665 2306..2638 189 56.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2421 2560..2670 166 65.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6823 1994..2103 161 66.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6798..6866 2320..2385 157 73.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6795..7008 2150..2353 150 59.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6773..7217 2142..2593 141 55 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1527..1584 2142..2200 130 71.2 Plus
roo 9092 roo DM_ROO 9092bp 1087..1142 2148..2200 128 75 Plus
looper1 1881 looper1 LOOPER1_DM 1881bp 1783..1875 3564..3658 119 60 Plus

RE26467.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:39:19 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12083453..12084850 2548..3945 99 == Plus
chr3R 12083290..12083366 2385..2461 100 == Plus
chr3R 12082969..12083224 2064..2319 100 == Plus
chr3R 12082236..12082860 1331..1955 100 == Plus
chr3R 12081416..12082141 511..1236 99 == Plus
chr3R 12067456..12067965 1..510 94 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:12:44 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 1..2739 499..3237 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:16 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 1..2739 499..3237 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:23 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 1..2739 499..3237 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:39:19 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 1..2739 499..3237 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:12:44 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 2..4000 1..3999 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:16 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 2..4000 1..3999 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:23 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 2..4000 1..3999 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:39:19 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
tara-RB 5..4066 1..4062 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:39:19 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16256778..16260333 511..4067 99   Plus
3R 16242820..16243329 1..510 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:23 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12082500..12086055 511..4067 99   Plus
arm_3R 12068542..12069051 1..510 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:19 Download gff for RE26467.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15997609..16001164 511..4067 99   Plus
3R 15983651..15984160 1..510 99 -> Plus

RE26467.pep Sequence

Translation from 498 to 3236

> RE26467.pep
MCTEVNSAMGLQATAATKRKHELTFDSKDANTTYTGNCAPPPVKANKWAI
SNNNYLESLEEQQQQQQSPSEPAVESNNNHIVLEASMDALKPTEPSISNG
HEVTTAVAAMKSQAEVPLPPTASAAIPEDSIARLEVVTSAVPCEPWTSNG
PTTPSAVAGPAASAEPVDCISKLQAVAVPSDPWGSIATRSTLATTLLSAD
ELDDDDDDFEDDYEEEESIIPTYCPMRYHPFVPHPHPHSHQLPSHPHQQQ
PQQLSQQQPHPQQQQLAQQQQQHPQQQRSYAPGYGSRQPNYYSEPFPQQN
CSRTGGPQHMTQSPPTPQQARGFAPPQWATAGSSPANPSSGAQQFYEPTN
GGAYAPPAAPQQTIRCAENGKSYLDLGCSSGASGNAGGSPISPPPSSAPV
VPFAGLPLHGLPLKRCCDGRPGGWCSANRSCYKDTRLKIRNLSMFKLSRF
RQVSEQSLYRSVLICNTLKRIDREIEAEAKELHQAAQQHHQQAAAAAAAA
AAAAAQAAQYHPAYQQQQQQQQSPPAPLHPHTQQQMDYAPVLNCARLANM
DHYQQLSFQPQHQQQQQPSQPHSYHERLDSQPAYRGAAAGAGSFATQPSN
CDTSAGASSSNTSGNSNNSSATAASSNSSLHPYDHYPFRESQSGRATPFP
ACPTTTAAAAAASAAAAASSGGAATTLSSNISSSPASSSTSSNTTSSTVI
SSSSGNTVSSNGTTPVAPTASSSNCDTSDSGYADDDSTRSINWSSVLSLS
SQSALDPLNNNDLFSILPSAATPTAVPVSVPASSSSSSSGSTLAFSGSFT
TVQASGGSSSSCGSSSTTATFTTLSTISSATHSLTSSYVSSISSNVSAGA
NTWEYGFLDMEFGLGSEFTELVPSCKLSSEDLFKSGLGGQVVTASRLHDN
ELEHPAHIMVGS*

RE26467.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23054-PA 921 GF23054-PA 3..921 1..912 2443 75.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16988-PA 913 GG16988-PA 7..913 3..912 3068 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18775-PA 921 GH18775-PA 278..921 278..912 1444 61.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
tara-PB 912 CG6889-PB 1..912 1..912 4760 100 Plus
tara-PA 916 CG6889-PA 7..916 3..912 4737 99.8 Plus
Mur29B-PA 555 CG31901-PA 212..475 587..852 215 30.3 Plus
cpo-PY 606 CG43738-PY 189..416 476..702 213 30.2 Plus
cpo-PX 606 CG43738-PX 189..416 476..702 213 30.2 Plus
Mur29B-PA 555 CG31901-PA 156..469 579..879 210 27.6 Plus
Mur29B-PA 555 CG31901-PA 148..410 587..852 209 28.1 Plus
Mur29B-PA 555 CG31901-PA 116..378 587..852 208 28.4 Plus
Mur29B-PA 555 CG31901-PA 92..346 595..852 198 27.9 Plus
cpo-PY 606 CG43738-PY 158..440 483..736 197 27.3 Plus
Mur29B-PA 555 CG31901-PA 90..309 602..844 190 30.5 Plus
Mur29B-PA 555 CG31901-PA 87..282 654..852 188 31.5 Plus
Mur29B-PA 555 CG31901-PA 108..356 603..852 188 27.4 Plus
Mur29B-PA 555 CG31901-PA 242..485 587..834 179 26.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22666-PA 941 GI22666-PA 3..665 1..652 1515 62 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12361-PA 937 GL12361-PA 1..377 5..378 1102 72.3 Plus
Dper\GL12361-PA 937 GL12361-PA 734..937 719..912 535 75.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19931-PB 962 GA19931-PB 3..962 1..912 2186 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15140-PA 910 GM15140-PA 1..910 1..912 3156 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19083-PA 914 GD19083-PA 3..914 1..912 3138 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23393-PA 907 GJ23393-PA 3..637 1..652 1618 66.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14470-PA 957 GK14470-PA 11..648 4..649 1357 57.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24381-PA 914 GE24381-PA 3..914 1..912 3044 96 Plus

RE26467.hyp Sequence

Translation from 498 to 3236

> RE26467.hyp
MCTEVNSAMGLQATAATKRKHELTFDSKDANTTYTGNCAPPPVKANKWAI
SNNNYLESLEEQQQQQQSPSEPAVESNNNHIVLEASMDALKPTEPSISNG
HEVTTAVAAMKSQAEVPLPPTASAAIPEDSIARLEVVTSAVPCEPWTSNG
PTTPSAVAGPAASAEPVDCISKLQAVAVPSDPWGSIATRSTLATTLLSAD
ELDDDDDDFEDDYEEEESIIPTYCPMRYHPFVPHPHPHSHQLPSHPHQQQ
PQQLSQQQPHPQQQQLAQQQQQHPQQQRSYAPGYGSRQPNYYSEPFPQQN
CSRTGGPQHMTQSPPTPQQARGFAPPQWATAGSSPANPSSGAQQFYEPTN
GGAYAPPAAPQQTIRCAENGKSYLDLGCSSGASGNAGGSPISPPPSSAPV
VPFAGLPLHGLPLKRCCDGRPGGWCSANRSCYKDTRLKIRNLSMFKLSRF
RQVSEQSLYRSVLICNTLKRIDREIEAEAKELHQAAQQHHQQAAAAAAAA
AAAAAQAAQYHPAYQQQQQQQQSPPAPLHPHTQQQMDYAPVLNCARLANM
DHYQQLSFQPQHQQQQQPSQPHSYHERLDSQPAYRGAAAGAGSFATQPSN
CDTSAGASSSNTSGNSNNSSATAASSNSSLHPYDHYPFRESQSGRATPFP
ACPTTTAAAAAASAAAAASSGGAATTLSSNISSSPASSSTSSNTTSSTVI
SSSSGNTVSSNGTTPVAPTASSSNCDTSDSGYADDDSTRSINWSSVLSLS
SQSALDPLNNNDLFSILPSAATPTAVPVSVPASSSSSSSGSTLAFSGSFT
TVQASGGSSSSCGSSSTTATFTTLSTISSATHSLTSSYVSSISSNVSAGA
NTWEYGFLDMEFGLGSEFTELVPSCKLSSEDLFKSGLGGQVVTASRLHDN
ELEHPAHIMVGS*

RE26467.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:16:54
Subject Length Description Subject Range Query Range Score Percent Strand
tara-PB 912 CG6889-PB 1..912 1..912 4760 100 Plus
tara-PA 916 CG6889-PA 7..916 3..912 4737 99.8 Plus
Mur29B-PA 555 CG31901-PA 212..475 587..852 215 30.3 Plus
cpo-PY 606 CG43738-PY 189..416 476..702 213 30.2 Plus
cpo-PX 606 CG43738-PX 189..416 476..702 213 30.2 Plus
Mur29B-PA 555 CG31901-PA 156..469 579..879 210 27.6 Plus
Mur29B-PA 555 CG31901-PA 148..410 587..852 209 28.1 Plus
Mur29B-PA 555 CG31901-PA 116..378 587..852 208 28.4 Plus
Mur29B-PA 555 CG31901-PA 92..346 595..852 198 27.9 Plus
cpo-PY 606 CG43738-PY 158..440 483..736 197 27.3 Plus
Mur29B-PA 555 CG31901-PA 90..309 602..844 190 30.5 Plus
Mur29B-PA 555 CG31901-PA 87..282 654..852 188 31.5 Plus
Mur29B-PA 555 CG31901-PA 108..356 603..852 188 27.4 Plus
Mur29B-PA 555 CG31901-PA 242..485 587..834 179 26.8 Plus