Clone RE27104 Report

Search the DGRC for RE27104

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:271
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCyp4d14-RA
Protein status:RE27104.pep: gold
Sequenced Size:1698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cyp4d14 2008-04-29 Picked prior to 5.5
Cyp4d14 2008-12-18 5.12 accounting

Clone Sequence Records

RE27104.complete Sequence

1698 bp assembled on 2008-11-06

GenBank Submission: BT050587.1

> RE27104.complete
AAGCAGTCGATGGCCAACGGTGCCAGTGTTAATAGATCCATCCCATTACC
AACCCGGAAAACCGAAACCCAAAAAACATGTATCTAGAGCTCTTTGCGAT
TCTCCTGGCGACCGCTTTGGCGTGGGATTATATGCGAAAGAGGCGGCACA
ACAAGATGTACGCCGAGGCTGGGATACGAGGACCCAAGAGCTATCCTCTG
GTTGGAAACGCTCCCTTGTTGATTAACGAGTCACCCAAGACTATCTTTGA
TATGCAGTTCCGACTGATTGCTGAGTTTGGTAAAAACATAAAAACGCAGA
TGTTGGGCGAAAGTGGCTTCATGACCGCTGATTCCAAAATGATCGAGGCG
ATCATGAGCAGCCAACAGACCATTCAAAAAAACAATCTTTATAGTCTGCT
GGTAAATTGGCTCGGCGATGGACTGCTCATTAGCCAAGGAAAGAAGTGGT
TCCGCCGCAGGAAGATCATTACACCCGCATTCCACTTTAAGATCCTCGAG
GACTTTGTGGAGGTCTTTGACCAACAGAGCGCAACTATGGTCCAGAAGCT
TTACGATCGGGCAGACGGCAAGACGGTGATAAACATGTTCCCGGTGGCTT
GCTTGTGTGCCATGGATATCATTGCGGAAACGGCCATGGGTGTAAAAATT
AATGCTCAGCTCCAGCCGCAATTTACCTACGTTCAGTCGGTCACAACTGC
CTCTGCAATGTTAGCCGAACGCTTCATGAATCCCTTGCAGCGCTTGGATT
TCACCATGAAGCTCTTCTATCCCAAATTGCTAGACAAGCTGAATGATGCC
GTGAAGAACATGCACGACTTTACCAACTCGGTAATCACTGAGCGACGCGA
GCTCCTACAAAAAGCCATTGCCGATGGAGGAGATGCCGACGCTGCCCTCT
TGAACGATGTGGGCCAGAAGCGTCGTATGGCTCTTCTTGATGTGCTGCTG
AAGTCCACCATCGATGGGGCTCCGTTGAGCAACGACGACATCCGCGAGGA
GGTAGACACCTTCATGTTCGAGGGTCATGACACTACGACCAGTAGCATTG
CTTTTACCTGTTATTTGCTGGCTCGACATCCTGAGGTTCAGGCTCGCGTC
TTCCAGGAGGTCAGAGATGTTATCGGTGATGACAAGTCGGCTCCAGTTAC
TATGAAGCTACTCGGCGAGCTCAAGTACTTAGAGTGCGTGATAAAGGAGT
CTCTGCGCCTGTTTCCCTCGGTGCCGATCATTGGACGCTACATTTCCCAG
GACACCGTACTCGACGGCAAATTGATACCCGCCGACTCGAATGTGATCAT
TCTTATTTACCATGCTCAGCGCGATCCAGACTACTTCCCTGATCCGGAGA
AGTTCATCCCTGATCGTTTCAGCATGGAGCGCAAGGGCGAGATCAGTCCA
TTCGCCTATACTCCCTTCTCAGCGGGTCCGAGAAACTGCATCGGCCAAAA
GTTCGCAATGCTCGAGATGAAGAGCACCATCAGCAAAATGGTGAGACACT
TTGAGTTGCTGCCTCTGGGCGAAGAAGTCCAGCCCGTACTGAACGTTATC
CTGCGCTCGACCACCGGAATCAATTGTGGCCTCAAGCCGCGCGTCTATTA
GGTGTTCCTGGATTGTGATTTTTTTTTTTTAACTAGTTGTAAGTGATGGG
CTCTGTAAATATTTGAATAAAATACTTGTACATAAAAAAAAAAAAAAA

RE27104.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-RA 1683 Cyp4d14-RA 1..1683 1..1683 8415 100 Plus
Cyp4d14.b 2001 Cyp4d14.b 319..2001 1..1683 8415 100 Plus
Cyp4d14.a 1692 Cyp4d14.a 250..1692 241..1683 7215 100 Plus
Cyp4d14.a 1692 Cyp4d14.a 1..240 1..240 1200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2067346..2068331 1683..698 4915 99.9 Minus
chrX 22417052 chrX 2068395..2068851 697..241 2285 100 Minus
chrX 22417052 chrX 2069005..2069244 240..1 1200 100 Minus
chrX 22417052 chrX 2071855..2071985 910..1040 355 84.7 Plus
chr3L 24539361 chr3L 7486348..7486485 1043..906 225 77.5 Minus
chrX 22417052 chrX 2072410..2072511 1412..1513 210 80.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:13:57
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-RA 1524 CG3540-PA 1..1524 78..1601 7620 100 Plus
Cyp4d14-RB 1533 CG3540-PB 1..1533 78..1601 7495 99.4 Plus
Cyp4d2-RB 1506 CG3466-PB 821..951 910..1040 355 84.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:57 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-RA 1685 CG3540-RA 3..1685 1..1683 8415 100 Plus
Cyp4d14-RB 1694 CG3540-RB 3..1694 1..1683 8290 99.5 Plus
Cyp4d2-RB 2467 CG3466-RB 1722..1852 910..1040 355 84.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-PA 507 CG3540-PA 1..507 78..1598 2520 100 Plus
Cyp4d14-PB 510 CG3540-PB 1..510 78..1598 2502 99.2 Plus
Cyp4d2-PB 501 CG3466-PB 8..500 90..1592 1355 54.3 Plus
Cyp4d2-PA 501 CG3466-PA 8..500 90..1592 1355 54.3 Plus
Cyp4d20-PA 510 CG16761-PA 1..506 78..1592 1163 45.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2173413..2174400 1685..698 4940 100 Minus
X 23542271 X 2174464..2174920 697..241 2285 100 Minus
X 23542271 X 2175074..2175313 240..1 1200 100 Minus
X 23542271 X 2177927..2178057 910..1040 355 84.7 Plus
3L 28110227 3L 7494248..7494385 1043..906 225 77.5 Minus
X 23542271 X 2178482..2178583 1412..1513 210 80.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2181511..2182498 1685..698 4940 100 Minus
X 23527363 X 2182562..2183018 697..241 2285 100 Minus
X 23527363 X 2183172..2183411 240..1 1200 100 Minus
X 23527363 X 2186025..2186155 910..1040 355 84.7 Plus
3L 28103327 3L 7487348..7487485 1043..906 225 77.5 Minus
X 23527363 X 2186580..2186681 1412..1513 210 80.3 Plus
Blast to na_te.dros performed on 2014-11-26 20:13:55 has no hits.

RE27104.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:24:14 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2069005..2069244 1..240 100   Minus
chrX 2068395..2068851 241..697 100 <- Minus
chrX 2067346..2068331 698..1683 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:06:06 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 1..1524 78..1601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:19:17 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 1..1524 78..1601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:59:51 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 1..1524 78..1601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:24:14 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 1..1524 78..1601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 08:00:02 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 1..1601 1..1601 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:19:16 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 1..1683 1..1683 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:59:51 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 3..1685 1..1683 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-06 10:07:53 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 1..1601 1..1601 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:24:14 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp4d14-RA 3..1685 1..1683 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:24:14 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
X 2175074..2175313 1..240 100   Minus
X 2174464..2174920 241..697 100 <- Minus
X 2173415..2174400 698..1683 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:59:51 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2069107..2069346 1..240 100   Minus
arm_X 2068497..2068953 241..697 100 <- Minus
arm_X 2067448..2068433 698..1683 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:50:35 Download gff for RE27104.complete
Subject Subject Range Query Range Percent Splice Strand
X 2183172..2183411 1..240 100   Minus
X 2182562..2183018 241..697 100 <- Minus
X 2181513..2182498 698..1683 100 <- Minus

RE27104.pep Sequence

Translation from 77 to 1600

> RE27104.pep
MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLIN
ESPKTIFDMQFRLIAEFGKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQ
KNNLYSLLVNWLGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQ
SATMVQKLYDRADGKTVINMFPVACLCAMDIIAETAMGVKINAQLQPQFT
YVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLDKLNDAVKNMHDFTN
SVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPL
SNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIG
DDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLI
PADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAG
PRNCIGQKFAMLEMKSTISKMVRHFELLPLGEEVQPVLNVILRSTTGINC
GLKPRVY*

RE27104.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21979-PA 505 GF21979-PA 1..505 1..507 2238 80.3 Plus
Dana\GF22196-PA 508 GF22196-PA 18..502 16..505 1430 54.9 Plus
Dana\GF24863-PA 507 GF24863-PA 16..506 16..505 1220 47.5 Plus
Dana\GF23785-PA 506 GF23785-PA 23..503 20..505 1139 47.2 Plus
Dana\GF22197-PA 497 GF22197-PA 41..497 40..507 1059 43.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12644-PA 507 GG12644-PA 1..507 1..507 2524 90.5 Plus
Dere\GG12913-PA 502 GG12913-PA 18..500 15..505 1373 54 Plus
Dere\GG14513-PA 508 GG14513-PA 16..506 16..505 1252 48.7 Plus
Dere\GG14956-PA 507 GG14956-PA 29..504 31..505 1154 45.8 Plus
Dere\GG10485-PA 510 GG10485-PA 13..507 13..506 1145 44 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21074-PA 509 GH21074-PA 1..509 1..507 1871 67 Plus
Dgri\GH16611-PA 518 GH16611-PA 1..511 1..505 1164 45.3 Plus
Dgri\GH15757-PA 506 GH15757-PA 16..505 16..506 1100 43.6 Plus
Dgri\GH24654-PA 705 GH24654-PA 228..705 36..507 998 43.1 Plus
Dgri\GH14221-PA 542 GH14221-PA 26..541 2..505 931 39.2 Plus
Dgri\GH24654-PA 705 GH24654-PA 13..196 7..184 298 35.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-PA 507 CG3540-PA 1..507 1..507 2599 100 Plus
Cyp4d14-PB 510 CG3540-PB 1..510 1..507 2581 99.2 Plus
Cyp4d2-PB 501 CG3466-PB 8..500 5..505 1364 54.3 Plus
Cyp4d2-PA 501 CG3466-PA 8..500 5..505 1364 54.3 Plus
Cyp4d20-PA 510 CG16761-PA 1..506 1..505 1186 46.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:29:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18674-PA 506 GI18674-PA 1..506 1..507 1898 68.7 Plus
Dmoj\GI12535-PA 513 GI12535-PA 16..512 16..506 1170 44.5 Plus
Dmoj\GI12456-PA 505 GI12456-PA 13..502 15..505 1163 45.8 Plus
Dmoj\GI22127-PA 533 GI22127-PA 26..532 2..505 949 39.6 Plus
Dmoj\GI16117-PA 511 GI16117-PA 39..510 38..506 921 40.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13400-PA 509 GL13400-PA 16..509 16..507 2172 80.2 Plus
Dper\GL13322-PA 508 GL13322-PA 2..503 1..505 1406 53.8 Plus
Dper\GL24610-PA 511 GL24610-PA 11..508 10..505 1258 48 Plus
Dper\GL13323-PA 502 GL13323-PA 41..502 40..507 1055 44 Plus
Dper\GL20343-PA 515 GL20343-PA 36..515 35..507 981 42.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17510-PA 509 GA17510-PA 16..509 16..507 2172 80.2 Plus
Dpse\GA22859-PA 509 GA22859-PA 2..504 1..505 1398 53.8 Plus
Dpse\GA14133-PA 511 GA14133-PA 11..508 10..505 1269 48.9 Plus
Dpse\GA18106-PA 507 GA18106-PA 27..503 29..505 1165 47.9 Plus
Dpse\GA22860-PA 502 GA22860-PA 41..502 40..507 1057 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18911-PA 507 GM18911-PA 1..507 1..507 2564 92.5 Plus
Dsec\GM19204-PA 501 GM19204-PA 8..500 5..505 1428 54.1 Plus
Dsec\GM14118-PA 508 GM14118-PA 1..508 1..507 1215 45.9 Plus
Dsec\GM16491-PA 510 GM16491-PA 1..506 1..505 1160 43.8 Plus
Dsec\GM13754-PA 507 GM13754-PA 29..504 31..505 1155 47 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16387-PA 507 GD16387-PA 1..507 1..507 2576 93.1 Plus
Dsim\Cyp4d2-PA 501 GD16592-PA 8..500 5..505 1433 54.5 Plus
Dsim\GD13389-PA 508 GD13389-PA 1..506 1..505 1218 46.3 Plus
Dsim\GD13053-PA 507 GD13053-PA 29..504 31..505 1167 46.7 Plus
Dsim\GD23477-PA 510 GD23477-PA 1..506 1..505 1161 43.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21689-PA 507 GJ21689-PA 1..507 1..507 1897 68.7 Plus
Dvir\GJ16052-PA 511 GJ16052-PA 16..510 16..506 1223 47.5 Plus
Dvir\GJ12358-PA 512 GJ12358-PA 1..504 1..505 1190 46.4 Plus
Dvir\GJ16500-PA 498 GJ16500-PA 2..494 1..504 1074 42.9 Plus
Dvir\GJ16396-PA 706 GJ16396-PA 228..705 36..506 969 42.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17014-PA 486 GK17014-PA 1..486 27..507 1888 70.8 Plus
Dwil\GK16039-PA 504 GK16039-PA 2..500 1..505 1255 49.7 Plus
Dwil\GK12509-PA 513 GK12509-PA 16..511 16..505 1191 45.2 Plus
Dwil\GK16803-PA 508 GK16803-PA 3..506 5..505 1180 45.9 Plus
Dwil\GK16044-PA 502 GK16044-PA 43..502 40..507 1047 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16972-PA 481 GE16972-PA 1..481 27..507 2410 91.5 Plus
Dyak\Cyp4d2-PA 502 GE16242-PA 13..500 10..505 1375 54.2 Plus
Dyak\GE21705-PA 508 GE21705-PA 16..506 16..505 1231 48.2 Plus
Dyak\GE20407-PA 508 GE20407-PA 29..505 31..505 1163 46.5 Plus
Dyak\GE14582-PA 510 GE14582-PA 1..506 1..505 1161 44.1 Plus

RE27104.hyp Sequence

Translation from 77 to 1600

> RE27104.hyp
MYLELFAILLATALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLIN
ESPKTIFDMQFRLIAEFGKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQ
KNNLYSLLVNWLGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQ
SATMVQKLYDRADGKTVINMFPVACLCAMDIIAETAMGVKINAQLQPQFT
YVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKLLDKLNDAVKNMHDFTN
SVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGAPL
SNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIG
DDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLI
PADSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAG
PRNCIGQKFAMLEMKSTISKMVRHFELLPLGEEVQPVLNVILRSTTGINC
GLKPRVY*

RE27104.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp4d14-PA 507 CG3540-PA 1..507 1..507 2599 100 Plus
Cyp4d14-PB 510 CG3540-PB 1..510 1..507 2581 99.2 Plus
Cyp4d2-PB 501 CG3466-PB 8..500 5..505 1364 54.3 Plus
Cyp4d2-PA 501 CG3466-PA 8..500 5..505 1364 54.3 Plus
Cyp4d20-PA 510 CG16761-PA 1..506 1..505 1186 46.6 Plus