Clone RE27522 Report

Search the DGRC for RE27522

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:275
Well:22
Vector:pFlc-1
Associated Gene/Transcriptpip-RK
Protein status:RE27522.pep: gold
Sequenced Size:1488

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
pip-RK 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE27522.complete Sequence

1488 bp assembled on 2010-12-06

GenBank Submission: BT125816.1

> RE27522.complete
AGTCAAGCCGCGATCGCCGAGCTCTACGGACGTCTATATCTCTAAGTCTT
CGAATCGTGAATCGGAACTCAAGTGAACCCAAGTGCCGACCGGAAAATTC
TTTCGGCCAAGAAAGGTCTTCGAGAACTAAGATCTCAAGCGATTGTGTTT
TTTGTGTAATTGACATTGGATGTCTCTGAACGCCGAGCGATCGTACAAAA
TGAAACTGCGCGATGTGGAAAATGCCTTCAAATACCGGCGCATACCGTAT
CCCAAGCGTTCCGTCGAGCTGATCGCCCTGCTGGCTATTTCGTGCACCTT
CTTCCTGTTCATGCACACCAACAAACTGAACAGTCGCCTCAAGGAGATGG
AGGTGAAGCTGCAGCCATCGGAGTTTTCGGCCCTCGGTCTAACGGGCAAC
CACATCAGCGGACACGATGCGGGCAAGCACGATGACATCAACACCCTGCA
CGGCACCTACCAATATCTGAAGAGCACTGGCCAGCTAAAACACCTGACCA
CCGCCCAGCTAAACAACACTCCTCGCGCCCAAGTGGACACGCTGTTCTTC
AATCGGATCACCAAGACCGGCAGCGAGAAGATGATGGAGTTGCTCAAGAT
CCTGGGCAAGCGCCACAACTTTGAGGCGCGTCGCGATGTTGAGGGATTCT
ACGAAGTAGTCATCATGCATGACGCCTTCGCCAAAAACTTTATCCGCACC
GAGGTACTCAACTGCACCAAAGCCAATAGCTATACGAAGCACGTAGCCTT
CCTGGACTTCGATCTACTGGACGAACCCTGGCCCATATACATCAATATGG
TGCGAGATCCCATCGAGCGGCTGGTCAGCTGGTTCTACTATGTCCGCGCC
CCCTGGCATTTCGCCGAGAGAAAGGAAATGTTCGGGGATGCCATCGTACT
GCCTAGCATAGATTGGCTCAGGAAGGACTTTAACCGCTGCATCGAGGAAC
GCGATCCCGAGTGTGTGTACGAGCAAATGGAAATGGGCAATCTGGGCGAT
CATAGGCGGCAGTCACTGTATCTCTGCGGTCAGAACATGGCGGTGTGCAT
GCCCTTCAACTCCCATGAGGCCATGCAGCGGGCCAAGAAGAATGTGGAGG
AGCACTACGCAGTGGTGGGAACCTGGGAGGATACGAACACCACGTTGTCG
GTTCTCGAGGGTTATATACCACGGTTCTTCAGTGGGGCCAAGGACCAGTA
CTACGCGTTGAGGAAAAGTTTGGGAAACTATAACAGGAATACCTACAGAC
CCAGTCTCAGTGACAAGGCAAGGGCCGTACTCAGCCAGAACCTCACCCGG
GAAATCGAGTTGTATCAGTTCGTCAGGCACCGGCTGTACAAGCAGTATAT
AGCCCTAAAGCTCGAAGAAGATCCCAAGCTGTGGGATTAGCAGAAATTTA
GTCACTAAGGATTCGTTGAAGAGTAATAAAACTATGCTAACTTTCGTTCT
GCTTCGATCTTTTCGATCAAAACAAAAAAAAAAAAAAA

RE27522.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19301106..19301675 1051..482 2850 100 Minus
chr3L 24539361 chr3L 19300382..19300804 1468..1046 2100 99.8 Minus
chr3L 24539361 chr3L 19326806..19327063 258..1 1275 99.6 Minus
chr3L 24539361 chr3L 19308271..19308438 425..258 840 100 Minus
chr3L 24539361 chr3L 19302639..19302701 488..426 300 98.4 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RK 1221 CG9614-PK 1..1221 170..1390 6105 100 Plus
pip-RM 879 CG9614-PM 1..317 170..486 1585 100 Plus
pip-RJ 1206 CG9614-PJ 1..317 170..486 1585 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
pip-RK 1478 CG9614-RK 11..1478 1..1468 7340 100 Plus
pip-RM 2975 CG9614-RM 11..496 1..486 2430 100 Plus
pip-RJ 1490 CG9614-RJ 11..496 1..486 2430 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PK 406 CG9614-PK 1..406 170..1387 2158 100 Plus
pip-PA 413 CG9614-PA 1..398 170..1369 1231 59.6 Plus
pip-PD 418 CG9614-PD 1..397 170..1369 1203 57.6 Plus
pip-PG 407 CG9614-PG 1..399 170..1369 1139 56.7 Plus
pip-PH 405 CG9614-PH 1..402 170..1381 1126 56.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19311618..19312187 1051..482 2850 100 Minus
3L 28110227 3L 19310894..19311316 1468..1046 2100 99.8 Minus
3L 28110227 3L 19337342..19337599 258..1 1290 100 Minus
3L 28110227 3L 19318784..19318951 425..258 840 100 Minus
3L 28110227 3L 19313152..19313214 488..426 300 98.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19304718..19305287 1051..482 2850 100 Minus
3L 28103327 3L 19303994..19304416 1468..1046 2100 99.7 Minus
3L 28103327 3L 19330442..19330699 258..1 1290 100 Minus
3L 28103327 3L 19311884..19312051 425..258 840 100 Minus
3L 28103327 3L 19306252..19306314 488..426 300 98.4 Minus
3L 28103327 3L 19302876..19302995 1170..1051 150 75 Minus
Blast to na_te.dros performed on 2014-11-27 16:32:17 has no hits.

RE27522.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:09 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19326806..19327063 1..258 99   Minus
chr3L 19308271..19308437 259..425 100 <- Minus
chr3L 19302643..19302701 426..484 100 <- Minus
chr3L 19301107..19301672 485..1050 100 <- Minus
chr3L 19300377..19300799 1051..1473 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-06 17:16:17 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 1..1221 170..1390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:33:36 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 1..1221 170..1390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:09 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 1..1221 170..1390 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-06 17:16:17 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 1..1390 1..1390 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:33:36 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 11..1478 1..1468 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:09 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
pip-RK 11..1478 1..1468 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:09 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19337342..19337599 1..258 100   Minus
3L 19318784..19318950 259..425 100 <- Minus
3L 19313156..19313214 426..484 100 <- Minus
3L 19311619..19312184 485..1050 100 <- Minus
3L 19310889..19311311 1051..1473 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:33:36 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19330442..19330699 1..258 100   Minus
arm_3L 19311884..19312050 259..425 100 <- Minus
arm_3L 19306256..19306314 426..484 100 <- Minus
arm_3L 19304719..19305284 485..1050 100 <- Minus
arm_3L 19303989..19304411 1051..1473 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:11 Download gff for RE27522.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19330442..19330699 1..258 100   Minus
3L 19311884..19312050 259..425 100 <- Minus
3L 19306256..19306314 426..484 100 <- Minus
3L 19304719..19305284 485..1050 100 <- Minus
3L 19303989..19304411 1051..1473 99 <- Minus

RE27522.pep Sequence

Translation from 169 to 1389

> RE27522.pep
MSLNAERSYKMKLRDVENAFKYRRIPYPKRSVELIALLAISCTFFLFMHT
NKLNSRLKEMEVKLQPSEFSALGLTGNHISGHDAGKHDDINTLHGTYQYL
KSTGQLKHLTTAQLNNTPRAQVDTLFFNRITKTGSEKMMELLKILGKRHN
FEARRDVEGFYEVVIMHDAFAKNFIRTEVLNCTKANSYTKHVAFLDFDLL
DEPWPIYINMVRDPIERLVSWFYYVRAPWHFAERKEMFGDAIVLPSIDWL
RKDFNRCIEERDPECVYEQMEMGNLGDHRRQSLYLCGQNMAVCMPFNSHE
AMQRAKKNVEEHYAVVGTWEDTNTTLSVLEGYIPRFFSGAKDQYYALRKS
LGNYNRNTYRPSLSDKARAVLSQNLTREIELYQFVRHRLYKQYIALKLEE
DPKLWD*

RE27522.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10764-PA 407 GF10764-PA 1..404 1..404 1889 83.9 Plus
Dana\GF10765-PA 342 GF10765-PA 34..317 114..396 717 48.1 Plus
Dana\GF10771-PA 319 GF10771-PA 10..303 105..400 698 45.3 Plus
Dana\GF10768-PA 851 GF10768-PA 555..844 109..400 587 42.2 Plus
Dana\GF10767-PA 301 GF10767-PA 5..298 103..400 561 42.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13411-PA 396 GG13411-PA 1..394 11..404 1997 91.1 Plus
Dere\GG13413-PA 516 GG13413-PA 209..501 106..400 698 45.8 Plus
Dere\GG13413-PA 516 GG13413-PA 1..147 139..277 220 31.8 Plus
Dere\GG21631-PA 349 GG21631-PA 74..319 124..385 212 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14407-PA 421 GH14407-PA 1..393 1..396 1245 59.3 Plus
Dgri\GH14414-PA 306 GH14414-PA 1..293 106..400 701 45.8 Plus
Dgri\GH14409-PA 617 GH14409-PA 298..596 98..400 640 41.9 Plus
Dgri\GH14410-PA 312 GH14410-PA 10..304 105..400 596 41.7 Plus
Dgri\GH14411-PA 314 GH14411-PA 12..306 105..400 586 41.3 Plus
Dgri\GH14409-PA 617 GH14409-PA 2..303 92..397 469 38.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PK 406 CG9614-PK 1..406 1..406 2158 100 Plus
pip-PA 413 CG9614-PA 1..398 1..400 1231 59.6 Plus
pip-PD 418 CG9614-PD 1..397 1..400 1203 57.6 Plus
pip-PG 407 CG9614-PG 1..399 1..400 1139 56.7 Plus
pip-PH 405 CG9614-PH 1..402 1..404 1126 56.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13536-PA 406 GI13536-PA 1..398 1..397 1591 72.6 Plus
Dmoj\GI13537-PA 371 GI13537-PA 55..343 109..396 721 47.9 Plus
Dmoj\GI13544-PA 306 GI13544-PA 4..293 109..400 700 46.3 Plus
Dmoj\GI13539-PA 314 GI13539-PA 1..293 105..400 660 42.1 Plus
Dmoj\GI13540-PA 304 GI13540-PA 2..296 105..400 590 42.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20901-PA 477 GL20901-PA 99..473 30..404 1748 82.7 Plus
Dper\GL20902-PA 357 GL20902-PA 42..331 108..396 720 46.7 Plus
Dper\GL20909-PA 532 GL20909-PA 223..517 104..400 697 45.5 Plus
Dper\GL20906-PA 471 GL20906-PA 6..295 108..400 650 42.9 Plus
Dper\GL20907-PA 322 GL20907-PA 23..315 106..400 553 40.9 Plus
Dper\GL20906-PA 471 GL20906-PA 284..459 93..267 302 39.6 Plus
Dper\GL20909-PA 532 GL20909-PA 26..214 177..390 270 35.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28234-PA 376 GA28234-PA 1..372 1..404 1697 76.7 Plus
Dpse\GA28240-PA 308 GA28240-PA 1..293 106..400 699 45.5 Plus
Dpse\GA28238-PA 1157 GA28238-PA 3..295 105..400 648 42.4 Plus
Dpse\GA28235-PA 285 GA28235-PA 1..259 139..396 641 46.5 Plus
Dpse\GA28238-PA 1157 GA28238-PA 284..592 93..400 598 42.4 Plus
Dpse\GA28238-PA 1157 GA28238-PA 599..888 109..400 551 40.9 Plus
Dpse\GA28236-PA 301 GA28236-PA 4..300 106..401 541 39.6 Plus
Dpse\GA28238-PA 1157 GA28238-PA 897..1141 106..353 489 41.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18995-PA 407 GM18995-PA 1..407 1..406 2135 96.3 Plus
Dsec\GM19105-PA 697 GM19105-PA 103..386 114..396 738 48.1 Plus
Dsec\GM14880-PA 308 GM14880-PA 1..293 106..400 699 45.8 Plus
Dsec\GM14871-PA 237 GM14871-PA 2..212 188..396 621 52.1 Plus
Dsec\GM14875-PA 282 GM14875-PA 2..261 137..400 556 40.8 Plus
Dsec\GM19105-PA 697 GM19105-PA 408..691 114..396 551 39.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12286-PA 397 GD12286-PA 1..397 11..406 2094 96.7 Plus
Dsim\GD12287-PA 516 GD12287-PA 209..501 106..400 697 45.8 Plus
Dsim\GD12287-PA 516 GD12287-PA 1..103 139..242 213 36.5 Plus
Dsim\GD21759-PA 349 GD21759-PA 74..319 124..385 211 28.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11895-PA 406 GJ11895-PA 1..401 1..401 1677 75.6 Plus
Dvir\GJ11896-PA 392 GJ11896-PA 81..364 114..396 730 49.1 Plus
Dvir\GJ11902-PA 306 GJ11902-PA 1..293 106..400 702 45.8 Plus
Dvir\GJ11899-PA 616 GJ11899-PA 7..296 108..400 663 42.9 Plus
Dvir\GJ11899-PA 616 GJ11899-PA 315..608 106..400 588 41.8 Plus
Dvir\GJ11897-PA 299 GJ11897-PA 4..293 106..396 569 40.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19566-PA 410 GK19566-PA 1..406 1..404 1828 81 Plus
Dwil\GK19555-PA 668 GK19555-PA 75..367 114..401 746 48.6 Plus
Dwil\GK19630-PA 301 GK19630-PA 1..293 106..400 700 45.8 Plus
Dwil\GK19587-PA 319 GK19587-PA 9..298 108..400 674 44.2 Plus
Dwil\GK19608-PA 616 GK19608-PA 9..302 106..400 605 43.5 Plus
Dwil\GK19555-PA 668 GK19555-PA 380..662 114..396 576 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22505-PA 351 GE22505-PA 29..350 85..406 1630 90.7 Plus
Dyak\GE22506-PA 968 GE22506-PA 103..386 114..396 738 48.4 Plus
Dyak\GE22927-PA 308 GE22927-PA 1..293 106..400 699 45.8 Plus
Dyak\GE22508-PA 1311 GE22508-PA 1004..1296 106..400 697 45.8 Plus
Dyak\GE22507-PA 821 GE22507-PA 512..800 109..400 665 42.7 Plus
Dyak\GE22508-PA 1311 GE22508-PA 42..262 179..400 508 43.9 Plus
Dyak\GE22506-PA 968 GE22506-PA 657..963 105..396 492 37.3 Plus
Dyak\GE22508-PA 1311 GE22508-PA 504..757 101..362 473 39 Plus
Dyak\GE22506-PA 968 GE22506-PA 408..667 114..372 470 39.7 Plus
Dyak\GE22508-PA 1311 GE22508-PA 264..498 105..341 469 39.8 Plus
Dyak\GE22508-PA 1311 GE22508-PA 741..1012 106..379 410 36.6 Plus

RE27522.hyp Sequence

Translation from 169 to 1389

> RE27522.hyp
MSLNAERSYKMKLRDVENAFKYRRIPYPKRSVELIALLAISCTFFLFMHT
NKLNSRLKEMEVKLQPSEFSALGLTGNHISGHDAGKHDDINTLHGTYQYL
KSTGQLKHLTTAQLNNTPRAQVDTLFFNRITKTGSEKMMELLKILGKRHN
FEARRDVEGFYEVVIMHDAFAKNFIRTEVLNCTKANSYTKHVAFLDFDLL
DEPWPIYINMVRDPIERLVSWFYYVRAPWHFAERKEMFGDAIVLPSIDWL
RKDFNRCIEERDPECVYEQMEMGNLGDHRRQSLYLCGQNMAVCMPFNSHE
AMQRAKKNVEEHYAVVGTWEDTNTTLSVLEGYIPRFFSGAKDQYYALRKS
LGNYNRNTYRPSLSDKARAVLSQNLTREIELYQFVRHRLYKQYIALKLEE
DPKLWD*

RE27522.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
pip-PK 406 CG9614-PK 1..406 1..406 2158 100 Plus
pip-PA 413 CG9614-PA 1..398 1..400 1231 59.6 Plus
pip-PD 418 CG9614-PD 1..397 1..400 1203 57.6 Plus
pip-PG 407 CG9614-PG 1..399 1..400 1139 56.7 Plus
pip-PH 405 CG9614-PH 1..402 1..404 1126 56.5 Plus