Clone RE29848 Report

Search the DGRC for RE29848

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:298
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCG7101-RA
Protein status:RE29848.pep: gold
Sequenced Size:1445

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7101-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE29848.complete Sequence

1445 bp assembled on 2009-08-05

GenBank Submission: BT089038.1

> RE29848.complete
GTGACAACAATTTTAATTGGACAAGCTAAAATTATGGAACCGGTGCCCAT
CCGGCCAAAAGCGCCGGGAGCGAGCAACCGCGGAGCCCTGCCGCTGGCGG
CGAAGAAGCCGGCCAAGAAGCGTACGTACCACTGCGGCGTTTGTTTTGCG
GAGTTCTCTCGTCATCTGGCCGCCAAGCGGCACGAGCAGCAGTGCTCCGT
CAGGGTGAGGCGTCTTTTCGTCTGCCCCCACTGCCTGACGCTTTTCGGCG
AGGAGGCCCGGCTGGAGCGGCATCGGGAGCGAAAGCACAACGATGGCCAG
TTCCTGTGCCTGCAGTGCGGCAAGAAGTACGCGTCAGCCACGTTTCTTTA
CCGTCATGTTGCCAGTTGGCACGGCCAGCAGTCGCTGTTCTACTGCGACA
TGTGCACGGACAACTGCAACGACGTTAAGACCTTTAGCGGGATGCTGGAG
CTGCAGGAGCACGCCGAGGAGGTGCATCGCCTGCGTACCCTGAAGTCCAC
GGCCAGTGATGCAGACAGCCAGGTTGATGAAATGGAGGATCTTGAGATGC
TAGAGGAGAACATTGAGAACATACTGCCCAGCATCGACTGGGACGACGAT
CTCACCTTTGGCTGGCCCACCGACCTGGACAAGGAGTCGTGCATTGTGAA
CGCTAAGCCGAGCGTTTTCGTGTGTCCCTTCTGCGCCAACGGATTCCCCG
GCAGTCTGAGCCTGGTGCGGCACCTGGAGCAGGTTCACGAACGCAGTGCC
CTGGACTGCTGCTACTGTGGCAAGAGCCATGGCAGCCGAGAAGCCCTGCG
GTCCCATCTGCAACGTGTTCACATCCTCTTGCGCGGTCATGTGTGCGGTA
TTTGCCAGGCGGACTTCGCCACTGCTGATCACCTAAAGAAGCACGTTAAC
AGTCTGCACCTGGACCACCGACCGCATCTGTGTCCCACGTGCGGAAAGAG
ATTCACCCAGCGGTGCCACCTCACCGATCACATAAAGACGGATCGCGGCC
ATGGACACGGCACTTACACCTGTGAATTCTGCGTGCGGCCCTTCTTCCGG
GCCATCGATCTCGAACGGCATGTGTGTGAGGAACATCCGTAGGGCAGTCA
ACCTAGCCGGAATCGTAGATACCTGAGCGACATCTCACGTCCAGAACTAC
GATTAATATATACTTAAGCAATGGATAAATGTAACGTTTTAATAGCGTTA
ATATTTTGAATTTATATCCTAGTCATCGGAAATGTTTTTCCAAACGAACT
TGAATTTAAAATCGTATTTTATTTTTTGCTGTAAAATTAATGCTTATGAG
ACGATTTACATTTACATTTTAGGAACTATAGACATAAGCGAATAGTTACT
TTAATATAGCAAGCAGATGGCTGAAAGACAATGTACTTATATGAATAAAA
AAATATCAATACATGAAGTCAGGTTAATAGAAAAAAAAAAAAAAA

RE29848.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-RA 1527 CG7101-RA 108..1527 4..1423 7085 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18720363..18721283 510..1430 4590 99.9 Plus
chrX 22417052 chrX 18719778..18720288 4..514 2555 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-RA 1059 CG7101-PA 1..1059 34..1092 5295 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-RA 1454 CG7101-RA 43..1454 4..1415 7045 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-PA 352 CG7101-PA 1..352 34..1089 1793 100 Plus
crol-PD 878 CG14938-PD 247..520 121..1074 254 25.9 Plus
crol-PG 878 CG14938-PG 247..557 121..1104 253 25.4 Plus
crol-PF 907 CG14938-PF 247..549 121..1074 245 25.3 Plus
crol-PB 891 CG14938-PB 361..641 127..1104 227 23.6 Plus
crol-PG 878 CG14938-PG 277..647 127..1104 216 22.3 Plus
crol-PD 878 CG14938-PD 277..647 127..1104 214 21.7 Plus
crol-PF 907 CG14938-PF 333..676 127..1104 199 22.1 Plus
crol-PG 878 CG14938-PG 249..402 667..1146 191 30.6 Plus
crol-PF 907 CG14938-PF 276..419 664..1110 190 31.3 Plus
crol-PD 878 CG14938-PD 276..430 664..1146 178 29.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18831218..18832141 510..1433 4605 99.9 Plus
X 23542271 X 18830633..18831143 4..514 2555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18839316..18840239 510..1433 4605 99.8 Plus
X 23527363 X 18838731..18839241 4..514 2555 100 Plus
Blast to na_te.dros performed on 2014-11-27 11:54:56 has no hits.

RE29848.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:35:44 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18720368..18721283 515..1430 99   Plus
chrX 18719775..18720288 1..514 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:53 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 1..1059 34..1092 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:56:37 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 1..1059 34..1092 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:34 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 1..1059 34..1092 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:35:44 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 1..1059 34..1092 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-05 16:50:51 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 25..1441 1..1417 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:56:37 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 65..1479 1..1415 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:34 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 40..1454 1..1415 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:35:44 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
CG7101-RA 40..1454 1..1415 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:35:44 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
X 18831223..18832138 515..1430 99   Plus
X 18830630..18831143 1..514 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:34 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18725256..18726171 515..1430 99   Plus
arm_X 18724663..18725176 1..514 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:48:09 Download gff for RE29848.complete
Subject Subject Range Query Range Percent Splice Strand
X 18839321..18840236 515..1430 99   Plus
X 18838728..18839241 1..514 99 -> Plus

RE29848.pep Sequence

Translation from 0 to 1091

> RE29848.pep
VTTILIGQAKIMEPVPIRPKAPGASNRGALPLAAKKPAKKRTYHCGVCFA
EFSRHLAAKRHEQQCSVRVRRLFVCPHCLTLFGEEARLERHRERKHNDGQ
FLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLE
LQEHAEEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDD
LTFGWPTDLDKESCIVNAKPSVFVCPFCANGFPGSLSLVRHLEQVHERSA
LDCCYCGKSHGSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVN
SLHLDHRPHLCPTCGKRFTQRCHLTDHIKTDRGHGHGTYTCEFCVRPFFR
AIDLERHVCEEHP*

RE29848.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19052-PA 354 GF19052-PA 1..353 12..362 1319 67.4 Plus
Dana\GF23400-PA 940 GF23400-PA 247..579 38..358 211 25 Plus
Dana\GF22319-PA 637 GF22319-PA 261..567 40..348 179 22.5 Plus
Dana\GF16931-PA 1364 GF16931-PA 1198..1332 219..357 179 33.1 Plus
Dana\GF20022-PA 182 GF20022-PA 10..141 223..358 167 30.9 Plus
Dana\GF23400-PA 940 GF23400-PA 394..701 75..363 161 22.9 Plus
Dana\GF23400-PA 940 GF23400-PA 225..467 74..358 160 23.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19189-PA 352 GG19189-PA 1..352 12..363 1584 83 Plus
Dere\GG10737-PA 586 GG10737-PA 448..579 223..357 186 34.6 Plus
Dere\GG10297-PA 612 GG10297-PA 42..283 75..358 184 24.2 Plus
Dere\GG25008-PA 615 GG25008-PA 204..554 40..358 182 21.8 Plus
Dere\GG25285-PA 558 GG25285-PA 202..341 218..358 182 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24519-PA 356 GH24519-PA 1..352 12..362 978 54 Plus
Dgri\GH13073-PA 979 GH13073-PA 276..608 38..358 210 25 Plus
Dgri\GH10788-PA 338 GH10788-PA 123..256 223..360 186 33.8 Plus
Dgri\GH12657-PA 899 GH12657-PA 476..729 75..358 177 28.7 Plus
Dgri\GH23243-PA 338 GH23243-PA 121..304 177..358 175 31.1 Plus
Dgri\GH13073-PA 979 GH13073-PA 423..730 75..363 161 22.9 Plus
Dgri\GH13073-PA 979 GH13073-PA 254..496 74..358 160 23.5 Plus
Dgri\GH10788-PA 338 GH10788-PA 150..286 222..362 157 29.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-PA 352 CG7101-PA 1..352 12..363 1959 100 Plus
crol-PG 878 CG14938-PG 244..552 38..362 266 25 Plus
crol-PF 907 CG14938-PF 244..549 38..358 266 25.5 Plus
crol-PD 878 CG14938-PD 244..520 38..358 261 25.7 Plus
CG5245-PA 501 CG5245-PA 105..410 38..362 248 25.5 Plus
crol-PF 907 CG14938-PF 287..671 25..363 222 21.3 Plus
crol-PG 878 CG14938-PG 277..642 43..363 220 22.1 Plus
crol-PD 878 CG14938-PD 277..642 43..363 217 21.7 Plus
crol-PG 878 CG14938-PG 222..492 74..358 212 25.1 Plus
crol-PD 878 CG14938-PD 222..492 74..358 196 23.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15085-PA 328 GI15085-PA 2..324 35..362 952 55.3 Plus
Dmoj\GI17692-PA 965 GI17692-PA 260..592 38..358 210 25 Plus
Dmoj\GI14828-PA 1155 GI14828-PA 734..987 45..358 196 27.5 Plus
Dmoj\GI17300-PA 323 GI17300-PA 113..246 223..360 188 33.8 Plus
Dmoj\GI17482-PA 432 GI17482-PA 6..298 68..358 179 23.2 Plus
Dmoj\GI17692-PA 965 GI17692-PA 407..714 75..363 162 23 Plus
Dmoj\GI17692-PA 965 GI17692-PA 238..480 74..358 157 23.5 Plus
Dmoj\GI17300-PA 323 GI17300-PA 140..276 222..362 155 30.5 Plus
Dmoj\GI17300-PA 323 GI17300-PA 16..216 186..358 151 27.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21335-PA 347 GL21335-PA 21..346 32..362 1022 56.5 Plus
Dper\GL18890-PA 932 GL18890-PA 238..570 38..358 211 25 Plus
Dper\GL21719-PA 1308 GL21719-PA 1146..1280 219..357 180 32.4 Plus
Dper\GL26275-PA 880 GL26275-PA 120..251 223..358 171 33.8 Plus
Dper\GL26275-PA 880 GL26275-PA 381..687 40..358 168 25.5 Plus
Dper\GL26188-PA 765 GL26188-PA 537..692 203..362 167 29.8 Plus
Dper\GL18890-PA 932 GL18890-PA 385..650 75..349 163 24.6 Plus
Dper\GL18890-PA 932 GL18890-PA 216..458 74..358 160 23.5 Plus
Dper\GL26275-PA 880 GL26275-PA 521..852 40..362 157 24.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20102-PA 347 GA20102-PA 21..346 32..362 1035 57.1 Plus
Dpse\GA25849-PB 870 GA25849-PB 303..544 75..358 185 24.2 Plus
Dpse\GA25849-PB 870 GA25849-PB 195..488 79..358 182 25.2 Plus
Dpse\GA11270-PB 1468 GA11270-PB 1306..1440 219..357 179 32.4 Plus
Dpse\GA16348-PA 769 GA16348-PA 541..696 203..362 167 29.8 Plus
Dpse\GA28105-PA 389 GA28105-PA 216..347 223..358 166 34.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22919-PA 350 GM22919-PA 1..350 12..363 1732 92.6 Plus
Dsec\GM10968-PA 929 GM10968-PA 244..576 38..358 210 25 Plus
Dsec\GM17699-PA 342 GM17699-PA 143..315 182..358 184 28.8 Plus
Dsec\GM20783-PA 583 GM20783-PA 445..576 223..357 182 35.3 Plus
Dsec\GM17841-PA 235 GM17841-PA 70..208 215..357 178 32.9 Plus
Dsec\GM10968-PA 929 GM10968-PA 391..656 75..349 161 24.6 Plus
Dsec\GM10968-PA 929 GM10968-PA 222..464 74..358 160 23.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17411-PA 350 GD17411-PA 1..350 12..363 1715 91.8 Plus
Dsim\GD21213-PA 1344 GD21213-PA 1179..1317 215..357 183 32.9 Plus
Dsim\GD10245-PA 583 GD10245-PA 445..576 223..357 182 35.3 Plus
Dsim\GD23545-PA 558 GD23545-PA 200..341 216..358 170 31 Plus
Dsim\GD22683-PA 479 GD22683-PA 365..472 225..327 169 36.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18892-PA 353 GJ18892-PA 1..349 12..362 1011 54 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 265..597 38..358 210 25 Plus
Dvir\GJ15680-PA 297 GJ15680-PA 120..253 223..360 191 33.8 Plus
Dvir\GJ23475-PA 1467 GJ23475-PA 1320..1450 223..357 175 33.3 Plus
Dvir\GJ20331-PA 278 GJ20331-PA 3..148 204..357 169 31.4 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 412..719 75..363 162 22.9 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 243..485 74..358 160 23.5 Plus
Dvir\GJ15680-PA 297 GJ15680-PA 150..283 225..362 151 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16523-PA 366 GK16523-PA 1..365 12..362 970 53.5 Plus
Dwil\GK14973-PA 1011 GK14973-PA 286..613 43..358 189 23.7 Plus
Dwil\GK14973-PA 1011 GK14973-PA 400..641 75..358 181 23.9 Plus
Dwil\GK12937-PA 1476 GK12937-PA 1310..1444 219..357 180 32.4 Plus
Dwil\GK24592-PA 479 GK24592-PA 365..472 225..327 172 36.4 Plus
Dwil\GK24172-PA 590 GK24172-PA 197..352 201..358 171 26.4 Plus
Dwil\GK14973-PA 1011 GK14973-PA 231..473 74..358 160 23.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17752-PA 352 GE17752-PA 1..352 12..363 1599 83.2 Plus
Dyak\GE25095-PA 274 GE25095-PA 33..247 139..358 192 27 Plus
Dyak\GE23893-PA 586 GE23893-PA 448..579 223..357 183 33.8 Plus
Dyak\GE23597-PA 1268 GE23597-PA 1102..1240 215..357 182 32.9 Plus
Dyak\GE18775-PA 558 GE18775-PA 200..341 216..358 180 32.4 Plus

RE29848.hyp Sequence

Translation from 0 to 1091

> RE29848.hyp
VTTILIGQAKIMEPVPIRPKAPGASNRGALPLAAKKPAKKRTYHCGVCFA
EFSRHLAAKRHEQQCSVRVRRLFVCPHCLTLFGEEARLERHRERKHNDGQ
FLCLQCGKKYASATFLYRHVASWHGQQSLFYCDMCTDNCNDVKTFSGMLE
LQEHAEEVHRLRTLKSTASDADSQVDEMEDLEMLEENIENILPSIDWDDD
LTFGWPTDLDKESCIVNAKPSVFVCPFCANGFPGSLSLVRHLEQVHERSA
LDCCYCGKSHGSREALRSHLQRVHILLRGHVCGICQADFATADHLKKHVN
SLHLDHRPHLCPTCGKRFTQRCHLTDHIKTDRGHGHGTYTCEFCVRPFFR
AIDLERHVCEEHP*

RE29848.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG7101-PA 352 CG7101-PA 1..352 12..363 1959 100 Plus
crol-PG 878 CG14938-PG 244..552 38..362 266 25 Plus
crol-PF 907 CG14938-PF 244..549 38..358 266 25.5 Plus
crol-PD 878 CG14938-PD 244..520 38..358 261 25.7 Plus
CG5245-PA 501 CG5245-PA 105..410 38..362 248 25.5 Plus
crol-PF 907 CG14938-PF 287..671 25..363 222 21.3 Plus
crol-PG 878 CG14938-PG 277..642 43..363 220 22.1 Plus
crol-PD 878 CG14938-PD 277..642 43..363 217 21.7 Plus
crol-PG 878 CG14938-PG 222..492 74..358 212 25.1 Plus
crol-PD 878 CG14938-PD 222..492 74..358 196 23.7 Plus