Clone RE29964 Report

Search the DGRC for RE29964

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:299
Well:64
Vector:pFlc-1
Associated Gene/TranscriptRgl-RB
Protein status:RE29964.pep: gold
Sequenced Size:3784

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Rgl-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE29964.complete Sequence

3784 bp assembled on 2009-08-27

GenBank Submission: BT099654.1

> RE29964.complete
AGTTGTTGCTGGGCGTTCGATGGCGCTTGGTCTCCGCGGTCTTGGCTTCT
AAGCCTCTGGAATGCCAACAATGTGTGCGCGTTCGGTTGTGGTTCATTTT
TTATAACTTCGTATATTTTTTTCAACTTTTATTGACCGTTTCATTTACGG
GCTACTGCTACTGTCGCACTTTCCATTGAGTTGAAATGGTTTTCACCCGA
ATGCTTTGTCGCTTTCTTGCAGTTTGATACATCCGCTTGGCCGAGTGAAT
TGCACAACCCAAATGAAAATAAATAAGTAAACGCGTTACACGTGTCCGCC
CAAAGAGTGTGTGCTTTCGAGTCATTGTTCGTCGTTAGCTGTGCCAAGCC
AAAATGCGCGTATCCGACAGATACCAGTCATCATCACAATTATCATCAGC
ATCTACAACACCACCATCGGAAATTGCATCGCACCAGATTTTGAGCAGCA
CGCACCTTGAAGTAATTGCAGCATCTGGCCATCGTCAACGCTGCAGACTA
TAATGAGTCAAAATGTGGCCGACAGTTTGCCCACGTGGCGCCTTTGGGGC
GAAGAGCACGAGAAGAATGCAATTTTCACCGTTTACCTGAAGAAAGTGCG
ATACCACCGACCGACGCCCACAGCCAGCAATGACTCAGATGATGAGATTT
CCCATCTGGAGTGGGAGACTGTACGCGTGCGTTTCGTTAAGGCGGCTACA
TTGGCTCGATTGGTGGAGGCGTTAGCCACCGACGACGGCGAGCTGGAGTC
CACCTTCATCAACGTGTTCCTGTCCACATATCGCACCTTCTCCACACCCA
AGCAGGTGCTCAGTCTGCTGACGCAACGGTACGATGCTCTGCATGAGAAG
CACCTGGAGGAGTTGGAGCAGGCACAGCAAAATGGACAGGTCATGGATCC
CGCCTACGATCCACACGCCTCCATTCACGAGCAGCACAAGAAAACCCTAG
TCTCAGCGCTGCACGTCTGGCTGGATGGATTCCCGGAGGATTGGCACGAG
GATAACCTGCAACAGATCTTGGCATTTGCCACCAAGCGGCTGAAACGATC
CGATCTGCACATCAAGGTGCTGAATCGTCTGGAACGGCTCATCAAACAGT
CTCTCTATGGAAATGGAGGAGGAAGCGGTGGCTCGGAGAACAATGGTCAT
TCGTGGCTTTCCGCAGCGCGCTCACAACAGATGCAGCAATTCATGATTCC
CACTCACTATGGCTCTTCGTATGACCTCACGGATCAGTTCAATGGCATGT
ACCTCTCGCCAATGGGCCACGGGCCCATCTATCGTGGACCTACCCACTTT
CTGCAGGCATTCCGTTTTCCGCATGTGCCCGTCCGGCATTTTGCTGAGCA
GTTGACCCGTATGGATACGGAACTCTTTAAGCGACTGATTCCCCACCAGT
GCCTCGGACACACGTGGGCACGACGTGATAGTGGAGGATCCGAGACTGTG
GTGGCCACCATCAACCAGTTTAATGCAGTGCTCTTCCGGGTGGTGTCCAG
TATCCTGATCGATCGCCTGAAACCTCAGGAGCGCGCTCTGAACATTTCAC
GATGGATTGATATTGCCCAAGAGTTGCGCATGCTCAAAAACTTTAGTTCG
CTCAAGGCCATCATTTCGGCTCTAAACTCCAATTCAATATACCGCCTCTC
CAAGATCTGGGAAGTGCTGCCTAAAGAAAGGATGGAAGTCTTTACGGAGC
TGGCGAATATTTGCTCGGAGGATAACAATGCTTGGACTCTGCGAGAAGTG
TTGAAACGAGAAGGAACGGCCAAAAATCCAGATCCAGGCAGTGATCACAG
CGATAGGCATCTGCAGAAGCTTATTCTGAATTTGGGAACACAAACATCGC
ATGGAACGATACCCTATTTGGGTACATTCCTTACCGACCTGACCATGATC
CATACGGCCAATCCGGACTACCTCACCGAGAATAAGCTCATAAACTTCGA
CAAGAAGCGCAAGGAGTTCGAAGTTCTGGCCCAGATCAAGTTACTTCAGG
GAGCAGCTAACACATATAATCTCCAGGCGGATGCGCTCTTTGATCATTGG
TTCAACTCAATGCCAGTGTTTGATGAGCGTGAAGCCTTTGAGCTGAGTTG
TCGACTGGAACCACCACCGCCGGCGCCACGGAAATCGGTGGTCAGCACTA
ACACCTCTTTAACAAACACGACCGCCTCATCGACGGCTTCTATTATGGGC
CACCGCAAGACTGACTCCATACACTCGAATTCGAGCAGCGGAGCGGGATC
ACAGTTCTACTGCGAACTAAACAGTAGTACCAGCTCCAGACATAACTCCT
TGGATCGGGATGTCCACCATCAGCACGCCTCCTTGATGTCCGCCTCGAGT
AGTGTGTCCAATCTGTCGTTGGACTCCAGTAACTCCGGCGGTCGGCAGTC
CGGCAAGCTGACCCACTCTCAGTCTATGGGAAATGGTCTGAAATCTCACG
GAAATGGCACTACGAATGGTGGATCGCCCCATATCAATGCTCAGTTGGTG
CAACCATCAAGTGGAACCCCTCACTCTGCTCCCGATTTCTATATCATTCG
GGTGACCTATGAAACAGACAACATCGAGCTGGATGGGATTGTGCTGTACA
AGAGTATTATGCTGGGAAATAACGAGCGCACGCCGCAGGTTATCCGAAAT
GCGATGCTTAAATTGGGTCTGGAGGATGATCCGGATAGGTTTACTTTGGC
GCAGGTCCTACCCGATAAGGAACTGGTGATGCCGAAGAATGCGAATGTCT
ACTACGCGGTTAACACAAACTACAACCTCAACTTCATCCTAAGACCGCGA
AAGGAAGAGGGTGTGGCAGGAAGCTAGTCCACAGCCGTGCCTCTGTCCCA
ATTGTGGTGTCTGGGATACGAGGGCGAGGAGTGAGGGTTAAGGATTATAC
ATTGGGGGGGAAATTGTAAATAGCTAGAGCTTGACTCGCCCATGACAAAA
CTGGATAAACCAATTTCTATTTAGGTTCGTAACTCGTTTAAGTTATTTAT
TTATTATTTGAAAAGTGCAAGGATAGTAGAAGGAAAGAAATCGATTAGTG
CGATTACCGATTATTTCGATTGATGTCTATTATTTCAAATGCTGTCAATT
ATCACTTAGCCAACTTTGTAATCTCTAATTTTTCGCAGGCCTTGAGTTGT
ATATGATTTAAAAGCCCAATCCAAAACATATATTATACAGAGACTCTACT
GGAATATTTGCTGATATTTACAAACACACATATACATTAAGTATATTTAC
TTATATACAACCATTGATATTCTAAATGTGGTACAATAATTTTAGATCTT
GAAACGGATATTGAGTTTGTTTAAGGATTCTCATTGTCTGTACTTAACTT
TGAGGTCTTAAAAACACAAACAACAAAGAATATTTGTATAGATGTTTTTA
CCCACAGTACGTGTATTATAAATACCAATTTAAATATAAGTACTATATGT
AACATTTTTCGAGTGGAGTGCACAACAACAAATATTGTTTTATCGATACT
TTAGCCGTATAAGATACCGTATTTCAGATTCTTTAAGTTATTTACATTGA
AAATTAATGAGAGAATGAAACAATTATACACTTACGGTATACACTAAGAA
TCTGCTTTGATTTATACATATTAAATATGATTAATATTTAACTACAAATT
TAAGTTAACGAAAGAAAAGAAGGAAAACAAAAGAATATTGTAAATATAAA
AGTGAAAATCGATAATTTGTGTTCTTCTGAAAAATAAATTGTACCAAAAG
AATGAAAAAAAAAAAAAGAAAAAAAAAAAAAAAA

RE29964.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-RC 3861 Rgl-RC 106..3861 1..3756 18735 99.9 Plus
Rgl.b 3798 Rgl.b 264..3794 226..3756 17610 99.9 Plus
Rgl.c 3787 Rgl.c 253..3783 226..3756 17610 99.9 Plus
Rgl.b 3798 Rgl.b 106..194 1..89 430 98.8 Plus
Rgl.c 3787 Rgl.c 106..179 1..74 370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13897082..13899149 3756..1681 10060 99.1 Minus
chr3L 24539361 chr3L 13899434..13899951 1529..1012 2575 99.8 Minus
chr3L 24539361 chr3L 13900011..13900394 1015..632 1920 100 Minus
chr3L 24539361 chr3L 13911846..13912149 529..226 1520 100 Minus
chr3L 24539361 chr3L 13912219..13912444 226..1 1130 100 Minus
chr3L 24539361 chr3L 13899210..13899365 1681..1526 780 100 Minus
chr3L 24539361 chr3L 13900641..13900744 632..529 520 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-RE 2922 CG8865-PE 567..2922 529..2884 11765 100 Plus
Rgl-RC 2325 CG8865-PC 1..2325 503..2827 11610 100 Plus
Rgl-RD 2325 CG8865-PD 1..2325 503..2827 11610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-RC 3754 CG8865-RC 1..3754 1..3754 18725 99.9 Plus
Rgl-RD 3865 CG8865-RD 337..3865 226..3754 17600 99.9 Plus
Rgl-RB 3939 CG8865-RB 411..3939 226..3754 17600 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-PE 973 CG8865-PE 174..973 482..2881 3630 98.1 Plus
Rgl-PC 774 CG8865-PC 1..774 503..2824 3572 100 Plus
Rgl-PD 774 CG8865-PD 1..774 503..2824 3572 100 Plus
Rgl-PB 774 CG8865-PB 1..774 503..2824 3572 100 Plus
Rgl-PA 954 CG8865-PA 174..954 482..2824 3535 98.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13906895..13908970 3756..1681 10335 99.9 Minus
3L 28110227 3L 13909255..13909772 1529..1012 2590 100 Minus
3L 28110227 3L 13909832..13910215 1015..632 1920 100 Minus
3L 28110227 3L 13921699..13922002 529..226 1520 100 Minus
3L 28110227 3L 13922072..13922297 226..1 1130 100 Minus
3L 28110227 3L 13909031..13909186 1681..1526 780 100 Minus
3L 28110227 3L 13910483..13910586 632..529 520 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13899995..13902070 3756..1681 10335 99.8 Minus
3L 28103327 3L 13902355..13902872 1529..1012 2590 100 Minus
3L 28103327 3L 13902932..13903315 1015..632 1920 100 Minus
3L 28103327 3L 13914799..13915102 529..226 1520 100 Minus
3L 28103327 3L 13915172..13915397 226..1 1130 100 Minus
3L 28103327 3L 13902131..13902286 1681..1526 780 100 Minus
3L 28103327 3L 13903583..13903686 632..529 520 100 Minus
Blast to na_te.dros performed 2014-11-27 12:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2478..2533 365..422 123 70.7 Plus

RE29964.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:02:31 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13912219..13912444 1..226 100   Minus
chr3L 13911846..13912148 227..529 100 <- Minus
chr3L 13900642..13900743 530..631 100 <- Minus
chr3L 13900011..13900394 632..1015 100 <- Minus
chr3L 13899435..13899947 1016..1528 99 <- Minus
chr3L 13899210..13899362 1529..1681 100 <- Minus
chr3L 13897084..13899148 1682..3754 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:12:58 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RC 1..2325 503..2827 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:51:47 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RC 1..2325 503..2827 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:36:00 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RE 560..2922 522..2884 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:02:31 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RE 560..2922 522..2884 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:12:58 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RC 1..3754 1..3754 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:51:46 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RC 1..3754 1..3754 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:36:00 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RC 1..3754 1..3754 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:02:31 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
Rgl-RC 1..3754 1..3754 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:02:31 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13922072..13922297 1..226 100   Minus
3L 13921699..13922001 227..529 100 <- Minus
3L 13910484..13910585 530..631 100 <- Minus
3L 13909832..13910215 632..1015 100 <- Minus
3L 13909256..13909768 1016..1528 100 <- Minus
3L 13909031..13909183 1529..1681 100 <- Minus
3L 13906897..13908969 1682..3754 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:36:00 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13915172..13915397 1..226 100   Minus
arm_3L 13914799..13915101 227..529 100 <- Minus
arm_3L 13903584..13903685 530..631 100 <- Minus
arm_3L 13902932..13903315 632..1015 100 <- Minus
arm_3L 13902356..13902868 1016..1528 100 <- Minus
arm_3L 13902131..13902283 1529..1681 100 <- Minus
arm_3L 13899997..13902069 1682..3754 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:27:53 Download gff for RE29964.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13915172..13915397 1..226 100   Minus
3L 13914799..13915101 227..529 100 <- Minus
3L 13903584..13903685 530..631 100 <- Minus
3L 13902932..13903315 632..1015 100 <- Minus
3L 13902356..13902868 1016..1528 100 <- Minus
3L 13902131..13902283 1529..1681 100 <- Minus
3L 13899997..13902069 1682..3754 99 <- Minus

RE29964.pep Sequence

Translation from 502 to 2826

> RE29964.pep
MSQNVADSLPTWRLWGEEHEKNAIFTVYLKKVRYHRPTPTASNDSDDEIS
HLEWETVRVRFVKAATLARLVEALATDDGELESTFINVFLSTYRTFSTPK
QVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQHKKTLV
SALHVWLDGFPEDWHEDNLQQILAFATKRLKRSDLHIKVLNRLERLIKQS
LYGNGGGSGGSENNGHSWLSAARSQQMQQFMIPTHYGSSYDLTDQFNGMY
LSPMGHGPIYRGPTHFLQAFRFPHVPVRHFAEQLTRMDTELFKRLIPHQC
LGHTWARRDSGGSETVVATINQFNAVLFRVVSSILIDRLKPQERALNISR
WIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTEL
ANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSH
GTIPYLGTFLTDLTMIHTANPDYLTENKLINFDKKRKEFEVLAQIKLLQG
AANTYNLQADALFDHWFNSMPVFDEREAFELSCRLEPPPPAPRKSVVSTN
TSLTNTTASSTASIMGHRKTDSIHSNSSSGAGSQFYCELNSSTSSRHNSL
DRDVHHQHASLMSASSSVSNLSLDSSNSGGRQSGKLTHSQSMGNGLKSHG
NGTTNGGSPHINAQLVQPSSGTPHSAPDFYIIRVTYETDNIELDGIVLYK
SIMLGNNERTPQVIRNAMLKLGLEDDPDRFTLAQVLPDKELVMPKNANVY
YAVNTNYNLNFILRPRKEEGVAGS*

RE29964.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10405-PA 958 GF10405-PA 182..958 2..774 3765 94.5 Plus
Dana\GF11409-PA 697 GF11409-PA 145..330 255..471 237 33 Plus
Dana\GF14259-PA 1587 GF14259-PA 824..1036 280..524 209 23.7 Plus
Dana\GF14515-PA 1577 GF14515-PA 862..1060 272..495 165 25.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13748-PA 962 GG13748-PA 195..962 2..774 3782 96.5 Plus
Dere\GG20630-PA 702 GG20630-PA 148..333 255..471 240 33 Plus
Dere\GG23884-PA 1582 GG23884-PA 829..1041 280..524 211 24.9 Plus
Dere\GG10404-PA 1566 GG10404-PA 862..1060 272..495 165 25 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16726-PA 995 GH16726-PA 213..994 2..772 3273 83.6 Plus
Dgri\GH11116-PA 1595 GH11116-PA 590..1056 41..544 276 23.2 Plus
Dgri\GH20366-PA 699 GH20366-PA 146..331 255..471 238 33.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-PC 774 CG8865-PC 1..774 1..774 4046 100 Plus
Rgl-PD 774 CG8865-PD 1..774 1..774 4046 100 Plus
Rgl-PB 774 CG8865-PB 1..774 1..774 4046 100 Plus
Rgl-PE 973 CG8865-PE 182..954 2..774 4007 99.1 Plus
Rgl-PA 954 CG8865-PA 182..954 2..774 4007 99.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:12:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13456-PA 995 GI13456-PA 210..993 2..773 3319 84.1 Plus
Dmoj\GI18240-PA 1592 GI18240-PA 590..1046 41..537 286 23.7 Plus
Dmoj\GI20039-PA 697 GI20039-PA 143..328 255..471 238 33.5 Plus
Dmoj\GI11520-PA 1588 GI11520-PA 856..1056 264..495 159 25 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15691-PA 925 GL15691-PA 200..808 2..606 2922 92 Plus
Dper\GL15691-PA 925 GL15691-PA 837..925 686..774 478 98.9 Plus
Dper\GL17736-PA 703 GL17736-PA 150..335 255..471 234 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21377-PA 976 GA21377-PA 201..976 2..774 3592 91.9 Plus
Dpse\GA18948-PB 666 GA18948-PB 150..335 255..471 235 33 Plus
Dpse\GA18948-PA 703 GA18948-PA 150..335 255..471 234 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24573-PA 980 GM24573-PA 208..980 2..774 4121 98.6 Plus
Dsec\GM15254-PA 1580 GM15254-PA 817..1029 280..524 213 24.9 Plus
Dsec\GM18620-PA 1545 GM18620-PA 840..1038 272..495 164 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12645-PA 926 GD12645-PA 187..926 35..774 3941 98.6 Plus
Dsim\GD11219-PA 702 GD11219-PA 148..333 255..471 240 33 Plus
Dsim\Sos-PA 1595 GD23927-PA 832..1044 280..524 212 24.9 Plus
Dsim\GD23402-PA 784 GD23402-PA 79..277 272..495 163 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11816-PA 976 GJ11816-PA 200..976 2..774 3481 87 Plus
Dvir\GJ21283-PA 699 GJ21283-PA 146..331 255..471 244 33.5 Plus
Dvir\GJ18146-PA 1597 GJ18146-PA 814..1057 281..544 208 24.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12433-PA 1001 GK12433-PA 228..999 10..773 3386 86.2 Plus
Dwil\GK21520-PA 691 GK21520-PA 137..322 255..471 238 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20045-PA 952 GE20045-PA 185..952 2..774 3752 95.5 Plus
Dyak\GE11819-PA 702 GE11819-PA 148..333 255..471 240 33 Plus
Dyak\GE18685-PA 1585 GE18685-PA 830..1042 280..524 212 24.9 Plus
Dyak\GE13791-PA 1569 GE13791-PA 863..1061 272..495 164 25 Plus

RE29964.hyp Sequence

Translation from 502 to 2826

> RE29964.hyp
MSQNVADSLPTWRLWGEEHEKNAIFTVYLKKVRYHRPTPTASNDSDDEIS
HLEWETVRVRFVKAATLARLVEALATDDGELESTFINVFLSTYRTFSTPK
QVLSLLTQRYDALHEKHLEELEQAQQNGQVMDPAYDPHASIHEQHKKTLV
SALHVWLDGFPEDWHEDNLQQILAFATKRLKRSDLHIKVLNRLERLIKQS
LYGNGGGSGGSENNGHSWLSAARSQQMQQFMIPTHYGSSYDLTDQFNGMY
LSPMGHGPIYRGPTHFLQAFRFPHVPVRHFAEQLTRMDTELFKRLIPHQC
LGHTWARRDSGGSETVVATINQFNAVLFRVVSSILIDRLKPQERALNISR
WIDIAQELRMLKNFSSLKAIISALNSNSIYRLSKIWEVLPKERMEVFTEL
ANICSEDNNAWTLREVLKREGTAKNPDPGSDHSDRHLQKLILNLGTQTSH
GTIPYLGTFLTDLTMIHTANPDYLTENKLINFDKKRKEFEVLAQIKLLQG
AANTYNLQADALFDHWFNSMPVFDEREAFELSCRLEPPPPAPRKSVVSTN
TSLTNTTASSTASIMGHRKTDSIHSNSSSGAGSQFYCELNSSTSSRHNSL
DRDVHHQHASLMSASSSVSNLSLDSSNSGGRQSGKLTHSQSMGNGLKSHG
NGTTNGGSPHINAQLVQPSSGTPHSAPDFYIIRVTYETDNIELDGIVLYK
SIMLGNNERTPQVIRNAMLKLGLEDDPDRFTLAQVLPDKELVMPKNANVY
YAVNTNYNLNFILRPRKEEGVAGS*

RE29964.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Rgl-PC 774 CG8865-PC 1..774 1..774 4046 100 Plus
Rgl-PD 774 CG8865-PD 1..774 1..774 4046 100 Plus
Rgl-PB 774 CG8865-PB 1..774 1..774 4046 100 Plus
Rgl-PE 973 CG8865-PE 182..954 2..774 4007 99.1 Plus
Rgl-PA 954 CG8865-PA 182..954 2..774 4007 99.1 Plus