Clone RE30881 Report

Search the DGRC for RE30881

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:308
Well:81
Vector:pFlc-1
Associated Gene/Transcriptachi-RA
Protein status:RE30881.pep: gold
Preliminary Size:815
Sequenced Size:2128

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8819 2001-12-14 Blastp of sequenced clone
CG8819 2002-01-01 Sim4 clustering to Release 2
CG8819 2003-01-01 Sim4 clustering to Release 3
achi 2008-04-29 Release 5.5 accounting
achi 2008-08-15 Release 5.9 accounting
achi 2008-12-18 5.12 accounting

Clone Sequence Records

RE30881.complete Sequence

2128 bp (2128 high quality bases) assembled on 2001-12-14

GenBank Submission: BT003510

> RE30881.complete
CGTGATTTCTTTCGCCACTAATTTGTTGTTTGGCACGCAGCAAGGAAAAG
GAATAAAACGCTTTAAAACCAGTGCCAAAATAGCTTTCCCCAACGTTCGT
TACTATATTTACGTTGTCTGCAAAAAGAGTTTGTCTAATTGGCCTCGATA
CTACGGTTGTGACGACTGCCCCGTCACTACAGTTTGCTGAGTGCAGTAAC
CGTGGCCTGGCTGAAACACTGGGAAAACCAGTGTTTAGTGTAAATAAATG
ATAGTGGCACCCATTCGGACATCGCAGCTTAAGTCTGAGCTGCAATGATC
TCGCCGGAACAAGAAGAGGTCAACATGGTCCTGGATCGCCATGTACGGCA
GAATATCCAGGACATGATGCACGAGGCTCATGTCCAGGCGAGCCTGCTGG
AGAACGAAGGACGCGGCCGTTTCCACTCGGACTCAAGTTTGGACCAGGAT
TCTCTTCACGCTGACGTCATCGTGGAGGAGGATCAGAGCACCGAACACGG
CGCCAACCAGGTGCAAAACTACCACGACATGATGGTGGACAGTGAACACC
ACATCGACATAAATGGGTCGCTGCGCAAACGTCGTGGAAATCTTCCCAAG
ACCTCTGTAAAGATTTTAAAGCGTTGGCTTTATGAGCACCGCTATAACGC
CTATCCGAGCGATGCGGAGAAGTTCACCCTGTCCCAGGAGGCCAATCTGA
CGGTGCTCCAAGTGTGCAACTGGTTCATCAATGCCCGTCGCCGCATTCTA
CCGGAGATGATCAGGCGCGAGGGCAACGATCCTCTGCACTTCACCATATC
GCGACGTGGCAAAAAGGTTAGCCCCAACTGTTCGAGATCAAGTGCGTTGG
GCGCAAACTTGACTGGGCCGAATCCCGCACACGGAAGTCCTGCTTCCGAA
GTGGTCGTTGGCGCTACAGAGGAGGTGGATGGCGCCGGTGAGATTCACGA
GGGCATCGCCAATGTGCTGACCAACTTTGAACAGTATGTGCAGGGCCCCA
ACGGACAAATGGTCAAGATGGAGCCGGAGTACGAGGACAGTGTCATCTAC
AGGTCCGAAGGCGAAGAGAGTGCACAGGGATACGAGTCCTGTGGGCCGAA
CAGCGAGGAGGAAGTACGCTTCGAGACCTCCCATGATTGGCAGAGCGTTA
TAAAAACTGTATTTGGTACTGAGGAAGTCAGCACTTCGGCTGGCAATAAT
CCAGGTACCTCTGGTTCTAAGGGATCTGTTCAGAATACCGCCATCTGGAA
TCGCAATCAGACTGCGAAGCGTGACGTGAATCAACAGTTGACTGACTTTG
AAAGCGAGCTGAATAGAATACAGGCCTCAGAAATCCAGACAATCGATCCT
ACCAACTCCAATCAACAGGACATTGGTGACAATCTACAGGCGGACGAGGT
GTTTACCGGTGCCGAAGCAGAAGCTGGCCAGAGTCAATTATCTGCTATGT
CGCAGGGCACAAGTCCAGATGAGCGTGCCAAGTACAAGTGTCTCTATTAT
CTAGTGGAAACTGCCATGGCTGTGCGCCAAAACGATGACGTCCAGGATGA
CGATTTCGTTTACATGGGAGACTAGAGCCTCAAACCAAATACCCACGCTA
CAGATCCCGACTTCCCAAAGTGCCGAAGCGTGTATATACAAATATGTATA
TATAGATATATATATATACTTAAGTAATTTAATCGAACAGCACTAGACCC
AAAAATTTGTCTATAACCCCCATGTTATTGTGTTAATTGAGTAGGTTACT
AACATAACGTACAAAGCTATAGATCAATTCGCAATGCGACCGCCCAAATA
CCTTTTTCCACAAAGTCAATTCACAAACAAATCGACTTAGTTTTGGACCT
GACTCTTTTAAACTTAACATGTACACTACTGATACTTAAATAAAACATAA
ACAAGCATTTGAAATACACATTGCCATAAAATGATGGTGTGTTTTATCTA
ATTGGCTGATAGAGCCATTTTTTTAAGGTATCTAGTAATTATGTACACAT
ACATACATAAAATGAGAACGTTTGTGGAAGGACAAAATTAATTTTGTTAT
AAATATTATAAATGTATTGGAATACTTTGGTTACCACAGATAATAAAGAG
TGGCGCAAAAACAAAAAAAAAAAAAAAA

RE30881.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:17
Subject Length Description Subject Range Query Range Score Percent Strand
achi-RA 2204 achi-RA 92..2204 4..2116 10550 99.9 Plus
achi.a 2028 achi.a 815..2028 903..2116 6070 100 Plus
achi-RC 2542 achi-RC 1477..2542 1051..2116 5330 100 Plus
achi-RC 2542 achi-RC 43..1091 4..1052 5230 99.9 Plus
achi.a 2028 achi.a 3..817 4..818 4060 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8398857..8399513 2112..1456 3270 99.8 Minus
chr2R 21145070 chr2R 8400889..8401386 905..408 2490 100 Minus
chr2R 21145070 chr2R 8397094..8397585 905..408 2095 95.2 Minus
chr2R 21145070 chr2R 8402099..8402372 277..4 1310 98.5 Minus
chr2R 21145070 chr2R 8395187..8395504 1953..1633 1000 90.8 Minus
chr2R 21145070 chr2R 8395493..8395705 1668..1456 915 95.3 Minus
chr2R 21145070 chr2R 8399577..8399758 1457..1276 910 100 Minus
chr2R 21145070 chr2R 8395782..8395963 1457..1276 850 97.8 Minus
chr2R 21145070 chr2R 8396886..8397037 1054..903 760 100 Minus
chr2R 21145070 chr2R 8400681..8400832 1054..903 760 100 Minus
chr2R 21145070 chr2R 8401455..8401586 407..276 660 100 Minus
chr2R 21145070 chr2R 8399824..8399945 1276..1155 610 100 Minus
chr2R 21145070 chr2R 8396029..8396150 1276..1155 580 98.4 Minus
chr2R 21145070 chr2R 8397644..8397775 407..276 540 93.9 Minus
chr2R 21145070 chr2R 8396210..8396314 1154..1050 525 100 Minus
chr2R 21145070 chr2R 8400005..8400109 1154..1050 525 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
achi-RA 1281 CG8819-PA 1..1281 295..1575 6405 100 Plus
vis-RA 1275 CG8821-PA 1..1275 295..1575 5695 96.5 Plus
achi-RD 1668 CG8819-PD 1..758 295..1052 3790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:48:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
achi-RA 2122 CG8819-RA 14..2122 4..2112 10530 100 Plus
vis-RA 1741 CG8821-RA 77..1461 278..1668 6185 96.5 Plus
achi-RD 2277 CG8819-RD 1216..2277 1051..2112 5310 100 Plus
vis-RA 1741 CG8821-RA 1450..1741 1633..1927 900 90.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
achi-PA 426 CG8819-PA 1..426 295..1572 2137 100 Plus
vis-PA 424 CG8821-PA 1..424 295..1572 2031 95.1 Plus
achi-PD 555 CG8819-PD 1..309 295..1242 1237 83.2 Plus
achi-PC 555 CG8819-PC 1..309 295..1242 1237 83.2 Plus
vis-PB 524 CG8821-PB 1..278 295..1242 973 69.3 Plus
achi-PD 555 CG8819-PD 370..555 1030..1572 902 95.7 Plus
achi-PC 555 CG8819-PC 370..555 1030..1572 902 95.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12511530..12512190 2116..1456 3305 100 Minus
2R 25286936 2R 12513566..12514063 905..408 2490 100 Minus
2R 25286936 2R 12509777..12510268 905..408 2095 95.2 Minus
2R 25286936 2R 12514776..12515049 277..4 1355 99.6 Minus
2R 25286936 2R 12507870..12508187 1953..1633 1000 90.8 Minus
2R 25286936 2R 12508176..12508388 1668..1456 915 95.3 Minus
2R 25286936 2R 12512254..12512435 1457..1276 910 100 Minus
2R 25286936 2R 12508465..12508646 1457..1276 850 97.8 Minus
2R 25286936 2R 12509569..12509720 1054..903 760 100 Minus
2R 25286936 2R 12513358..12513509 1054..903 760 100 Minus
2R 25286936 2R 12514129..12514263 410..276 675 100 Minus
2R 25286936 2R 12512501..12512622 1276..1155 610 100 Minus
2R 25286936 2R 12508712..12508833 1276..1155 580 98.4 Minus
2R 25286936 2R 12510327..12510458 407..276 540 93.9 Minus
2R 25286936 2R 12508893..12508997 1154..1050 525 100 Minus
2R 25286936 2R 12512682..12512786 1154..1050 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12512729..12513389 2116..1456 3305 100 Minus
2R 25260384 2R 12514765..12515262 905..408 2490 100 Minus
2R 25260384 2R 12510976..12511400 905..481 1990 97.8 Minus
2R 25260384 2R 12515975..12516248 277..4 1355 99.6 Minus
2R 25260384 2R 12509069..12509386 1953..1633 1050 90.7 Minus
2R 25260384 2R 12509375..12509587 1668..1456 915 95.3 Minus
2R 25260384 2R 12513453..12513634 1457..1276 910 100 Minus
2R 25260384 2R 12509664..12509845 1457..1276 850 97.8 Minus
2R 25260384 2R 12514557..12514708 1054..903 760 100 Minus
2R 25260384 2R 12510768..12510919 1054..903 760 100 Minus
2R 25260384 2R 12515328..12515462 410..276 675 100 Minus
2R 25260384 2R 12513700..12513821 1276..1155 610 100 Minus
2R 25260384 2R 12509911..12510032 1276..1155 580 98.3 Minus
2R 25260384 2R 12511526..12511657 407..276 540 93.9 Minus
2R 25260384 2R 12513881..12513985 1154..1050 525 100 Minus
2R 25260384 2R 12510092..12510196 1154..1050 525 100 Minus
2R 25260384 2R 12511414..12511467 461..408 210 92.5 Minus
Blast to na_te.dros performed 2014-11-27 00:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsub\GEM 1730 Dsub\GEM GEM 1730bp 1319..1367 2041..1995 123 75.5 Minus

RE30881.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:32:46 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8402099..8402374 1..277 98   Minus
chr2R 8401453..8401584 278..409 99 <- Minus
chr2R 8400891..8401384 410..903 100 <- Minus
chr2R 8400683..8400831 904..1052 100 <- Minus
chr2R 8400005..8400106 1053..1154 100 <- Minus
chr2R 8399824..8399945 1155..1276 100 <- Minus
chr2R 8399578..8399757 1277..1456 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:08:52 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..1281 295..1575 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:04:56 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..1281 295..1575 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:13 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..1281 295..1575 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:29:36 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..1281 295..1575 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:46 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..1281 295..1575 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:32:36 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..2111 1..2112 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:04:56 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..2111 1..2112 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:13 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 12..2122 1..2112 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:29:37 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..2111 1..2112 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:46 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 12..2122 1..2112 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:32:46 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12514776..12515051 1..277 99   Minus
2R 12514130..12514261 278..409 100 <- Minus
2R 12513568..12514061 410..903 100 <- Minus
2R 12513360..12513508 904..1052 100 <- Minus
2R 12512682..12512783 1053..1154 100 <- Minus
2R 12512501..12512622 1155..1276 100 <- Minus
2R 12512255..12512434 1277..1456 100 <- Minus
2R 12511534..12512189 1457..2112 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:13 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8402281..8402556 1..277 99   Minus
arm_2R 8401635..8401766 278..409 100 <- Minus
arm_2R 8401073..8401566 410..903 100 <- Minus
arm_2R 8400865..8401013 904..1052 100 <- Minus
arm_2R 8400187..8400288 1053..1154 100 <- Minus
arm_2R 8400006..8400127 1155..1276 100 <- Minus
arm_2R 8399760..8399939 1277..1456 100 <- Minus
arm_2R 8399039..8399694 1457..2112 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:05:39 Download gff for RE30881.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12515975..12516250 1..277 99   Minus
2R 12515329..12515460 278..409 100 <- Minus
2R 12514767..12515260 410..903 100 <- Minus
2R 12514559..12514707 904..1052 100 <- Minus
2R 12513881..12513982 1053..1154 100 <- Minus
2R 12513700..12513821 1155..1276 100 <- Minus
2R 12513454..12513633 1277..1456 100 <- Minus
2R 12512733..12513388 1457..2112 100 <- Minus

RE30881.pep Sequence

Translation from 294 to 1574

> RE30881.pep
MISPEQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSSLD
QDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNL
PKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR
ILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPA
SEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSV
IYRSEGEESAQGYESCGPNSEEEVRFETSHDWQSVIKTVFGTEEVSTSAG
NNPGTSGSKGSVQNTAIWNRNQTAKRDVNQQLTDFESELNRIQASEIQTI
DPTNSNQQDIGDNLQADEVFTGAEAEAGQSQLSAMSQGTSPDERAKYKCL
YYLVETAMAVRQNDDVQDDDFVYMGD*

RE30881.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 16:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12447-PA 580 GF12447-PA 1..269 1..252 1170 83.3 Plus
Dana\GF12447-PA 580 GF12447-PA 404..580 250..426 450 59.2 Plus
Dana\GF17520-PA 487 GF17520-PA 366..428 94..156 195 52.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 16:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22573-PA 562 GG22573-PA 1..261 1..252 1219 86.4 Plus
Dere\GG22573-PA 562 GG22573-PA 387..562 250..426 728 79.8 Plus
Dere\GG17283-PA 487 GG17283-PA 366..428 94..156 195 52.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 16:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20569-PA 583 GH20569-PA 1..261 1..252 1017 73.6 Plus
Dgri\GH20569-PA 583 GH20569-PA 420..577 253..424 285 45.4 Plus
Dgri\GH19106-PA 456 GH19106-PA 335..397 94..156 195 52.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
achi-PA 426 CG8819-PA 1..426 1..426 2224 100 Plus
vis-PA 424 CG8821-PA 1..424 1..426 2110 95.3 Plus
achi-PD 555 CG8819-PD 1..309 1..316 1324 83.2 Plus
achi-PC 555 CG8819-PC 1..309 1..316 1324 83.2 Plus
vis-PB 524 CG8821-PB 1..278 1..316 1052 69.6 Plus
achi-PD 555 CG8819-PD 370..555 246..426 902 95.7 Plus
achi-PC 555 CG8819-PC 370..555 246..426 902 95.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 16:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19763-PA 578 GI19763-PA 1..264 1..252 1028 73.7 Plus
Dmoj\GI14777-PA 221 GI14777-PA 90..213 93..214 333 53.6 Plus
Dmoj\GI19763-PA 578 GI19763-PA 414..574 253..426 305 44.8 Plus
Dmoj\GI23559-PA 472 GI23559-PA 351..413 94..156 195 52.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 16:44:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10213-PA 557 GL10213-PA 1..270 1..252 878 65.6 Plus
Dper\GL10213-PA 557 GL10213-PA 393..555 253..424 336 44.8 Plus
Dper\GL23828-PA 266 GL23828-PA 145..207 94..156 193 52.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 16:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21345-PB 435 GA21345-PB 1..433 1..424 1199 58.4 Plus
Dpse\GA21345-PA 557 GA21345-PA 1..270 1..252 879 66.9 Plus
Dpse\GA21345-PA 557 GA21345-PA 393..555 253..424 327 44.8 Plus
Dpse\GA14330-PD 460 GA14330-PD 339..401 94..156 195 52.4 Plus
Dpse\GA14330-PA 457 GA14330-PA 336..398 94..156 195 52.4 Plus
Dpse\GA14330-PH 217 GA14330-PH 96..158 94..156 194 52.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 16:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20355-PA 549 GM20355-PA 1..246 1..252 1225 90.9 Plus
Dsec\GM20354-PA 532 GM20354-PA 1..229 1..252 1108 83.3 Plus
Dsec\GM20355-PA 549 GM20355-PA 375..549 253..426 800 88.6 Plus
Dsec\GM20354-PA 532 GM20354-PA 358..532 253..426 799 88.6 Plus
Dsec\GM26167-PA 487 GM26167-PA 366..428 94..156 195 52.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 16:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25834-PA 535 GD25834-PA 1..246 1..252 1209 89.7 Plus
Dsim\GD25834-PA 535 GD25834-PA 375..535 253..426 735 84 Plus
Dsim\GD25833-PA 145 GD25833-PA 6..145 288..426 628 87.1 Plus
Dsim\GD20718-PA 487 GD20718-PA 366..428 94..156 195 52.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 16:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18217-PA 501 GJ18217-PA 1..263 1..252 1028 73.7 Plus
Dvir\GJ18823-PA 212 GJ18823-PA 84..206 72..203 353 53.8 Plus
Dvir\GJ23538-PA 470 GJ23538-PA 349..411 94..156 195 52.4 Plus
Dvir\GJ18217-PA 501 GJ18217-PA 394..442 253..301 184 75.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 16:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17831-PA 559 GK17831-PA 1..257 1..252 968 72.7 Plus
Dwil\GK17831-PA 559 GK17831-PA 395..555 255..423 218 39.5 Plus
Dwil\GK22581-PA 486 GK22581-PA 365..427 94..156 195 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 16:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13442-PA 566 GE13442-PA 1..264 1..252 1285 90.5 Plus
Dyak\GE13442-PA 566 GE13442-PA 390..566 250..426 726 82.1 Plus
Dyak\GE24684-PA 487 GE24684-PA 366..428 94..156 195 52.4 Plus

RE30881.hyp Sequence

Translation from 294 to 1574

> RE30881.hyp
MISPEQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSSLD
QDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNL
PKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR
ILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPA
SEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSV
IYRSEGEESAQGYESCGPNSEEEVRFETSHDWQSVIKTVFGTEEVSTSAG
NNPGTSGSKGSVQNTAIWNRNQTAKRDVNQQLTDFESELNRIQASEIQTI
DPTNSNQQDIGDNLQADEVFTGAEAEAGQSQLSAMSQGTSPDERAKYKCL
YYLVETAMAVRQNDDVQDDDFVYMGD*

RE30881.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
achi-PA 426 CG8819-PA 1..426 1..426 2224 100 Plus
vis-PA 424 CG8821-PA 1..424 1..426 2110 95.3 Plus
achi-PD 555 CG8819-PD 1..309 1..316 1324 83.2 Plus
achi-PC 555 CG8819-PC 1..309 1..316 1324 83.2 Plus
vis-PB 524 CG8821-PB 1..278 1..316 1052 69.6 Plus
achi-PD 555 CG8819-PD 370..555 246..426 902 95.7 Plus
achi-PC 555 CG8819-PC 370..555 246..426 902 95.7 Plus