Clone RE31203 Report

Search the DGRC for RE31203

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:312
Well:3
Vector:pFlc-1
Associated Gene/Transcriptl(2)gl-RB
Protein status:RE31203.pep: gold
Sequenced Size:4440

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
l(2)gl-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE31203.complete Sequence

4440 bp assembled on 2009-10-19

GenBank Submission: BT100129.1

> RE31203.complete
ACTAGACCCACCGATCGCGACTTTGTGTGTGTTAAAATGACGCGCATATC
GTTTTGGGCTAATAATATTGTTCACGTTTTATAAAACAGATACACGGTTA
AGCTCTGACCGGTCGTATTATTATCTGTGTGTTCTTGGTTGACACGTTTA
TTTCATTTATTCTCATTTAAAGCAACGATGTGAAGAACAGTGCGGGCGTT
TCTCAACATAAGAATACATACAAACTTATGCGTGATGTTTAGAATAAATT
CGGCCACAATTAATATACTTATTTATTCATCAAAACCAAACCACCACAAG
AGCATAACCAATCATGTTAAAGTTTATCAGAGGAAAAGGGCAGCAGCCCA
GTGCTGACAGACAACGCTACATCACGGCACAGCATGGCTTTCCTCATAAG
CCTTCGGCTCTTGCGTATGATCCAGTTTTGAAACTTATGGCAATAGGGAC
GCAAACAGGGGCTTTAAAAGTTTTCGGTCAACCCGGAGTTGAATTGTACG
GTCAGCATACTTTGTTAAACAATTCAGCATCGGAGCTTAATGTACAATTA
CTTGAATGGGTGTATGGAACTGGTCGCATACTTTCGTTGACGGCAGCGAA
TCAATTAATTCTATGGGAGCCAGTTGGAGCAACGTTGCTGCCAATCAAAA
CACTACCGTTTGACGGCAAACTTAAAAAAGTTTCATCGCTGTGCTGTTCT
CTCAGTAAGGATCTGCTATGGATTGGAACAGAAGGTGGAAACATCTATCA
ACTGGATTTACATACATTTACCATTAAGGAGCCTGTAATTTACCATGACG
TTGTGCTAGAGCAGGTGCCACCAGCCTACAAGCTAAATCCTGGTGCAATT
GAGTCAATCCGCCAACTTCCAAACTCCCCTAGCAAACTTCTAGTTGCATA
CAATCGCGGCCTTTGTGTTTTGTGGGATTTTGAAAGCGCATCTGTCCAGC
GAGCATACATAGCCCCTGGACATGGACAGAGCGTTGGTCTTACAGTGAAC
TTCGAAGGATCTGAATTTACCTGGTACCACGCTGATGGTTCATACGCCAC
TTGGAGCATAGATAACCCAGAACCGCCGTCGAATGTTAATTATGTGCCTT
ATGGACCTGATCCATGCAAAAGCATAAATCGACTGTACAAAGGCAAGCGA
AGATCCAACGATGTAATTGTTTTTTCCGGCGGCATGCCACGGTCAGCATA
TGGTGATCACAATTGTGTGTCCGTTCACGCCAGCGATGGACACAAAGTGT
GTCTTGACTTTACGTCTAAAGTGATTGACTTTTTTGTGACCTTTGAAAAT
AATAGAGATGTCGCTGAAGTTCTTGTTGTACTACTTGAAGAGGAACTCTG
CGCTTACGATCTTACTGACCCTAATATTTGTGCTATCAAAGCGCCATATC
TTCACTCTGTCCATGCATCAGCTGTCACTTGCAATTACCTTGCTTCTGAA
GTCGTACAGTCGGTATATGAAAGTATTTTAAGAGCTGGAGATGAACAAGA
CATTGACTATAGCAATATTAGCTGGCCTATCACTGGCGGTACTCTCCCGG
ATAACTTAGAAGAATCTGTAGAAGAGGACGCGACTAAGCTTTATGAGATT
TTGTTAACTGGTCACGAAGATGGTTCTGTTAAATTTTGGGACTGCACTGG
AGTGTTGCTTAAACCAATTTATAATTTTAAAACTAGCAGCATTTTTGGAA
GTGAGTCAGACTTCCGAGATGACGCAGCTGCAGATATGAGTGCGGAACAA
GTCGATGAAGGAGAACCGCCATTTCGGAAATCAGGACTTTTTGATCCTTA
TTCAGATGACCCTCGTTTAGCAGTGAAGAAAATAGCATTCTGCCCAAAAA
CCGGACAACTTATTGTTGGTGGCACAGCGGGCCAAATAGTTATAGCCGAC
TTCATAGACTTACCCGAAAAAGTGTCTTTAAAATACATTTCAATGAATTT
GGTCAGCGATCGTGATGGATTTGTGTGGAAGGGTCACGATCAGTTAAACG
TGCGATCGAACTTATTAGACGGAGAAGCAATTCCTACGACGGAACGTGGT
GTAAATATATCGGGAGTACTGCAAGTTTTGCCGCCAGCCAGCATAACATG
CATGGCACTCGAAGCAAGCTGGGGCCTAGTATCTGGTGGGACTGCGCACG
GCTTAGTTCTCTTTGACTTCAAAAACTTTGTTCCAGTATTTCATCGCTGC
ACTTTAAACCCAAATGATCTTACTGGAGCAGGAGAGCAGCTGTCTCGTCG
AAAGTCTTTTAAGAAATCATTGAGGGAGTCATTTAGAAAGCTTCGCAAGG
GTCGATCGACCAGGACCAACCAGAGCAATCAAGTACCAACAACGCTGGAA
GCAAGACCCGTCGAGAGGCAAATAGAGGCTCGTTGTGCAGATGACGGGCT
AGGATCCATGGTGCGATGTTTACTATTTGCCAAAACTTATGTTACTAATG
TCAACATAACGTCGCCAACTTTGTGGTCAGCAACAAATGCCAGTACAGTC
TCGGTTTTCCTTCTGCATTTGCCACCAGCGCAGACCGCGGCAACTGCCGT
CCCGTCGGCAAGTGGCAATGCACCACCACACATGCCCCGCCGAATTTCTG
CGCAGCTTGCTAAAGAAATACAATTAAAACATCGTGCTCCTGTGGTGGGT
ATTTCTATTTTTGATCAGGCGGGTAGCCCTGTCGATCAGCTGAACGCCGG
TGAAAACGGGAGTCCACCGCATCGTGTACTTATTGCTTCCGAGGAACAGT
TCAAGGTGTTTTCACTTCCGCAACTAAAGCCGATTAACAAATATAAGCTT
ACCGCTAACGAAGGTGCTCGGATTCGCCGCATCCATTTTGGTTCGTTTAG
TTGTCGCATATCCCCGGAAACACTGCAGAGTATGCACGGTTGTAGCCCAA
CTAAGTCCACGCGTTCACATGGCGATGGAGAGGCGGATCCTAATATCAGT
GGAAGCTTGGCTGTAAGTCGTGGAGATGTATATAACGAAACAGCATTGAT
ATGTTTAACGAATATGGGCGATATCATGGTTTTATCAGTACCTGAATTAA
AAAGACAGCTGAATGCCGCAGCAGTGCGACGGGAAGACATTAATGGAGTT
TCGTCACTTTGCTTTACAAACTCTGGAGAAGCACTGTATATGATGTCTTC
TTCTGAACTGCAGCGTATTGCTTTAGCCACGTCCAGAGTCGTGCAACCCA
CTGGCGTTGTTCCAGTAGAACCATTAGAAAATGAAGAGTCTGTGTTGGAA
GAAAATGATGCAGAGAATAATAAGGAAACCTACGCATGTGATGAAGTTGT
GAATACATATGAAATTAAAAATCCATCAGGCATTTCAATATGCACAAGGC
CTGCAGAGGAAAACGTTGGAAGAAATAGTGTTCAGCAAGTTAATGGAGTC
AACATTTCAAATTCACCTAATCAAGCTAACGAGACTATCAGCAGCTCTAT
TGGCGATATTACCGTTGACTCGGTGCGCGACCATTTAAATATGACGACCA
CCACTTTGTGTTCTATTAATACAGAGGAAACCATTGGTCGCCTATCTGTA
CTTAGCACGCAAACCAACAAAGCCAGTACTACCGTAAACATGAGTGAAAT
TCCAAATATTAATATTTCTAATTTAGAGGACTTGGAATCGAAAAGAAATA
CGACGGAAACGAGTACTAGTTCTGTTGTAATTAAATCTATAATTACAAAC
ATTTCTCATGAAAAAACGAACGGAGACAACAAAATAGGAACGCCAAAAAC
AGCGCCTGAAGAAAGCCAATTTTAACATTGACAGAAGCCGTAACCTACTA
ATTATTTTATACCTTTACAGAAATACGACGCAAACGAGTACTAGTCCTGA
TGTAATTTAATCTATAATTACAAACATGTCTCACTAAAAATCGAACGGGG
ACAGCAAAATAGGAACGCAAAAAAATTAAATTAAATTAAACGCGATTTAC
ATACAAACAGAAATGACAGAATGATAATATAAAATATTCATTTTTTATTT
GGCTTAAGCGATGTTGTTGTTCCAAAACCATATAATTATTTATGATTTTA
TGTAATGTTTTCATGTATTTTCGCGTAGTGACTTTATACCCTTTACCCGT
ATGATGAAACGAAACATGATATTTGTAGAAAGGTACAAAGGATAAAAGTT
GACATTTAAGGCCGATTGTAAAATATTAAAACGCAACCTGGATAACATGC
CGATTAATTACTTCTGTTCGTCCGTATAAACACAAATACCGATAAATTGG
TCCGTCCCCATTTAATAAATTGTATATTAAAATGGTCTTTATTTTGGATA
AATAATTCAAATTATATAGGAACATTTGGGTTTTAAGGGATAGAAACAGC
GCTGGTGTCTTTCATTTCCGTTCGTATGACCGTTCAAAGATTATAAAAAA
ATTGTCGTGCCCACAAAAAAAAAAGAAAAAAAAAAAAAAA

RE31203.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl.a 5685 l(2)gl.a 648..4689 374..4415 20210 100 Plus
l(2)gl.d 5831 l(2)gl.d 794..4835 374..4415 20210 100 Plus
l(2)gl.b 5275 l(2)gl.b 604..3766 374..3536 15815 100 Plus
l(2)gl.b 5275 l(2)gl.b 3766..4536 3645..4415 3855 100 Plus
l(2)gl.d 5831 l(2)gl.d 256..628 1..373 1865 100 Plus
l(2)gl.a 5685 l(2)gl.a 40..276 1..237 1185 100 Plus
l(2)gl.b 5275 l(2)gl.b 1..237 1..237 1185 100 Plus
l(2)gl.a 5685 l(2)gl.a 346..482 237..373 685 100 Plus
l(2)gl.b 5275 l(2)gl.b 306..438 241..373 665 100 Plus
l(2)gl.a 5685 l(2)gl.a 487..617 237..367 550 94.6 Plus
l(2)gl.d 5831 l(2)gl.d 633..763 237..367 550 94.6 Plus
l(2)gl.b 5275 l(2)gl.b 443..573 237..367 550 94.6 Plus
l(2)gl.b 5275 l(2)gl.b 3940..4045 3644..3749 365 89.6 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13677..14870 2344..1151 5970 100 Minus
chr2L 23010047 chr2L 14927..15705 1152..374 3895 100 Minus
chr2L 23010047 chr2L 10572..11343 4415..3644 3830 99.7 Minus
chr2L 23010047 chr2L 12283..12926 3093..2450 3220 100 Minus
chr2L 23010047 chr2L 11774..12218 3538..3094 2225 100 Minus
chr2L 23010047 chr2L 21129..21365 237..1 1185 100 Minus
chr2L 23010047 chr2L 18328..18561 234..1 1170 100 Minus
chr2L 23010047 chr2L 19878..20014 373..237 685 100 Minus
chr2L 23010047 chr2L 11407..11516 3645..3536 550 100 Minus
chr2L 23010047 chr2L 17077..17207 367..237 550 94.7 Minus
chr2L 23010047 chr2L 13514..13620 2450..2344 535 100 Minus
chr2L 23010047 chr2L 11238..11390 3924..3774 400 85.6 Minus
chr2L 23010047 chr2L 11063..11168 3749..3644 365 89.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-RB 3462 CG2671-PB 1..3462 314..3775 17310 100 Plus
l(2)gl-RJ 3486 CG2671-PJ 85..3486 374..3775 17010 100 Plus
l(2)gl-RI 3486 CG2671-PI 85..3486 374..3775 17010 100 Plus
l(2)gl-RB 3462 CG2671-PB 3331..3436 3819..3924 365 89.6 Plus
l(2)gl-RJ 3486 CG2671-PJ 3355..3460 3819..3924 365 89.6 Plus
l(2)gl-RJ 3486 CG2671-PJ 1..54 314..367 255 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-RB 5155 CG2671-RB 5..4419 1..4415 22075 100 Plus
l(2)gl-RF 5082 CG2671-RF 163..4346 237..4415 20810 99.9 Plus
l(2)gl-RD 5230 CG2671-RD 311..4494 237..4415 20810 99.9 Plus
l(2)gl-RB 5155 CG2671-RB 3648..3753 3819..3924 365 89.6 Plus
l(2)gl-RB 5155 CG2671-RB 3823..3928 3644..3749 365 89.6 Plus
l(2)gl-RF 5082 CG2671-RF 3575..3680 3819..3924 365 89.6 Plus
l(2)gl-RF 5082 CG2671-RF 3750..3855 3644..3749 365 89.6 Plus
l(2)gl-RF 5082 CG2671-RF 29..93 173..237 325 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-PB 1153 CG2671-PB 1..1153 314..3772 5596 100 Plus
l(2)gl-PJ 1161 CG2671-PJ 1..1161 314..3772 5557 99.1 Plus
l(2)gl-PI 1161 CG2671-PI 1..1161 314..3772 5557 99.1 Plus
l(2)gl-PH 1161 CG2671-PH 1..1161 314..3772 5557 99.1 Plus
l(2)gl-PG 1161 CG2671-PG 1..1161 314..3772 5557 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13683..14876 2344..1151 5970 100 Minus
2L 23513712 2L 14933..15711 1152..374 3895 100 Minus
2L 23513712 2L 10575..11346 4415..3644 3860 100 Minus
2L 23513712 2L 12286..12929 3093..2450 3220 100 Minus
2L 23513712 2L 11777..12221 3538..3094 2225 100 Minus
2L 23513712 2L 21136..21372 237..1 1185 100 Minus
2L 23513712 2L 18334..18567 234..1 1170 100 Minus
2L 23513712 2L 19885..20021 373..237 685 100 Minus
2L 23513712 2L 11410..11519 3645..3536 550 100 Minus
2L 23513712 2L 17083..17213 367..237 550 94.7 Minus
2L 23513712 2L 13520..13626 2450..2344 535 100 Minus
2L 23513712 2L 11241..11393 3924..3774 400 85.6 Minus
2L 23513712 2L 11066..11171 3749..3644 365 89.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13683..14876 2344..1151 5970 100 Minus
2L 23513712 2L 14933..15711 1152..374 3895 100 Minus
2L 23513712 2L 10575..11346 4415..3644 3860 100 Minus
2L 23513712 2L 12286..12929 3093..2450 3220 100 Minus
2L 23513712 2L 11777..12221 3538..3094 2225 100 Minus
2L 23513712 2L 21136..21372 237..1 1185 100 Minus
2L 23513712 2L 18334..18567 234..1 1170 100 Minus
2L 23513712 2L 19885..20021 373..237 685 100 Minus
2L 23513712 2L 11410..11519 3645..3536 550 100 Minus
2L 23513712 2L 17083..17213 367..237 550 94.6 Minus
2L 23513712 2L 13520..13626 2450..2344 535 100 Minus
2L 23513712 2L 11241..11393 3924..3774 410 85.6 Minus
Blast to na_te.dros performed 2014-11-27 15:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1470..1772 3684..3984 157 53.7 Plus
opus 7521 opus OPUS 7521bp 6119..6210 3906..3997 126 62.4 Plus

RE31203.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:26:08 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 21129..21365 1..237 100   Minus
chr2L 19878..20013 238..373 100 <- Minus
chr2L 14927..15705 374..1152 100 <- Minus
chr2L 13677..14868 1153..2344 100 <- Minus
chr2L 13514..13619 2345..2450 100 <- Minus
chr2L 12283..12925 2451..3093 100 <- Minus
chr2L 11776..12218 3094..3536 100 <- Minus
chr2L 11407..11515 3537..3645 100 <- Minus
chr2L 10573..11341 3646..4414 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:16:21 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 1..3462 314..3775 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:45:58 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 1..3462 314..3775 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:58:40 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 1..3462 314..3775 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:26:08 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 1..3462 314..3775 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:16:20 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 1..4414 1..4414 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:45:58 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 1..4414 1..4414 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:58:40 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 5..4418 1..4414 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:26:08 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)gl-RB 5..4418 1..4414 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:26:08 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21136..21372 1..237 100   Minus
2L 19885..20020 238..373 100 <- Minus
2L 14933..15711 374..1152 100 <- Minus
2L 13683..14874 1153..2344 100 <- Minus
2L 13520..13625 2345..2450 100 <- Minus
2L 12286..12928 2451..3093 100 <- Minus
2L 11779..12221 3094..3536 100 <- Minus
2L 11410..11518 3537..3645 100 <- Minus
2L 10576..11344 3646..4414 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:58:40 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 21136..21372 1..237 100   Minus
arm_2L 19885..20020 238..373 100 <- Minus
arm_2L 14933..15711 374..1152 100 <- Minus
arm_2L 13683..14874 1153..2344 100 <- Minus
arm_2L 13520..13625 2345..2450 100 <- Minus
arm_2L 12286..12928 2451..3093 100 <- Minus
arm_2L 11779..12221 3094..3536 100 <- Minus
arm_2L 11410..11518 3537..3645 100 <- Minus
arm_2L 10576..11344 3646..4414 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:26:10 Download gff for RE31203.complete
Subject Subject Range Query Range Percent Splice Strand
2L 21136..21372 1..237 100   Minus
2L 19885..20020 238..373 100 <- Minus
2L 14933..15711 374..1152 100 <- Minus
2L 13683..14874 1153..2344 100 <- Minus
2L 13520..13625 2345..2450 100 <- Minus
2L 12286..12928 2451..3093 100 <- Minus
2L 11779..12221 3094..3536 100 <- Minus
2L 11410..11518 3537..3645 100 <- Minus
2L 10576..11344 3646..4414 100 <- Minus

RE31203.pep Sequence

Translation from 313 to 3774

> RE31203.pep
MLKFIRGKGQQPSADRQRYITAQHGFPHKPSALAYDPVLKLMAIGTQTGA
LKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLIL
WEPVGATLLPIKTLPFDGKLKKVSSLCCSLSKDLLWIGTEGGNIYQLDLH
TFTIKEPVIYHDVVLEQVPPAYKLNPGAIESIRQLPNSPSKLLVAYNRGL
CVLWDFESASVQRAYIAPGHGQSVGLTVNFEGSEFTWYHADGSYATWSID
NPEPPSNVNYVPYGPDPCKSINRLYKGKRRSNDVIVFSGGMPRSAYGDHN
CVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDL
TDPNICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILRAGDEQDIDYS
NISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDCTGVLLK
PIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDP
RLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDR
DGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALE
ASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNPNDLTGAGEQLSRRKSFK
KSLRESFRKLRKGRSTRTNQSNQVPTTLEARPVERQIEARCADDGLGSMV
RCLLFAKTYVTNVNITSPTLWSATNASTVSVFLLHLPPAQTAATAVPSAS
GNAPPHMPRRISAQLAKEIQLKHRAPVVGISIFDQAGSPVDQLNAGENGS
PPHRVLIASEEQFKVFSLPQLKPINKYKLTANEGARIRRIHFGSFSCRIS
PETLQSMHGCSPTKSTRSHGDGEADPNISGSLAVSRGDVYNETALICLTN
MGDIMVLSVPELKRQLNAAAVRREDINGVSSLCFTNSGEALYMMSSSELQ
RIALATSRVVQPTGVVPVEPLENEESVLEENDAENNKETYACDEVVNTYE
IKNPSGISICTRPAEENVGRNSVQQVNGVNISNSPNQANETISSSIGDIT
VDSVRDHLNMTTTTLCSINTEETIGRLSVLSTQTNKASTTVNMSEIPNIN
ISNLEDLESKRNTTETSTSSVVIKSIITNISHEKTNGDNKIGTPKTAPEE
SQF*

RE31203.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14872-PA 1162 GF14872-PA 1..1162 1..1153 4883 82 Plus
Dana\GF21382-PA 1726 GF21382-PA 42..680 21..672 581 27.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24690-PA 1159 GG24690-PA 1..1159 1..1153 5650 92.9 Plus
Dere\GG17733-PA 1676 GG17733-PA 42..680 21..672 577 26.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11726-PA 1162 GH11726-PA 1..1162 1..1153 4660 77.8 Plus
Dgri\GH12594-PA 1711 GH12594-PA 42..676 21..672 573 27.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-PB 1153 CG2671-PB 1..1153 1..1153 5978 100 Plus
l(2)gl-PJ 1161 CG2671-PJ 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PI 1161 CG2671-PI 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PH 1161 CG2671-PH 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PG 1161 CG2671-PG 1..1161 1..1153 5939 99.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:15:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16268-PA 1166 GI16268-PA 1..1166 1..1153 4676 78.2 Plus
Dmoj\GI16223-PA 1671 GI16223-PA 42..676 21..672 562 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13933-PA 1397 GL13933-PA 1..1123 1..1117 4874 81.6 Plus
Dper\GL13139-PA 1201 GL13139-PA 42..769 21..737 584 25.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\l(2)gl-PA 1166 GA15420-PA 1..1166 1..1153 5007 82.1 Plus
Dpse\GA22963-PA 1802 GA22963-PA 42..680 21..672 566 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16707-PA 1161 GM16707-PA 1..1161 1..1153 5866 95.6 Plus
Dsec\GM11577-PA 1076 GM11577-PA 42..531 21..542 541 28.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:15:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22996-PA 1161 GD22996-PA 1..1161 1..1153 5898 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16212-PA 1155 GJ16212-PA 1..1155 1..1153 4712 77.8 Plus
Dvir\GJ15915-PA 1560 GJ15915-PA 42..676 21..672 576 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24602-PA 1165 GK24602-PA 1..1165 1..1153 4615 77 Plus
Dwil\GK25516-PA 1722 GK25516-PA 42..681 21..672 561 26.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16527-PA 1161 GE16527-PA 1..1161 1..1153 5761 93.6 Plus
Dyak\GE17022-PA 1944 GE17022-PA 42..680 21..672 575 26.9 Plus

RE31203.hyp Sequence

Translation from 313 to 3774

> RE31203.hyp
MLKFIRGKGQQPSADRQRYITAQHGFPHKPSALAYDPVLKLMAIGTQTGA
LKVFGQPGVELYGQHTLLNNSASELNVQLLEWVYGTGRILSLTAANQLIL
WEPVGATLLPIKTLPFDGKLKKVSSLCCSLSKDLLWIGTEGGNIYQLDLH
TFTIKEPVIYHDVVLEQVPPAYKLNPGAIESIRQLPNSPSKLLVAYNRGL
CVLWDFESASVQRAYIAPGHGQSVGLTVNFEGSEFTWYHADGSYATWSID
NPEPPSNVNYVPYGPDPCKSINRLYKGKRRSNDVIVFSGGMPRSAYGDHN
CVSVHASDGHKVCLDFTSKVIDFFVTFENNRDVAEVLVVLLEEELCAYDL
TDPNICAIKAPYLHSVHASAVTCNYLASEVVQSVYESILRAGDEQDIDYS
NISWPITGGTLPDNLEESVEEDATKLYEILLTGHEDGSVKFWDCTGVLLK
PIYNFKTSSIFGSESDFRDDAAADMSAEQVDEGEPPFRKSGLFDPYSDDP
RLAVKKIAFCPKTGQLIVGGTAGQIVIADFIDLPEKVSLKYISMNLVSDR
DGFVWKGHDQLNVRSNLLDGEAIPTTERGVNISGVLQVLPPASITCMALE
ASWGLVSGGTAHGLVLFDFKNFVPVFHRCTLNPNDLTGAGEQLSRRKSFK
KSLRESFRKLRKGRSTRTNQSNQVPTTLEARPVERQIEARCADDGLGSMV
RCLLFAKTYVTNVNITSPTLWSATNASTVSVFLLHLPPAQTAATAVPSAS
GNAPPHMPRRISAQLAKEIQLKHRAPVVGISIFDQAGSPVDQLNAGENGS
PPHRVLIASEEQFKVFSLPQLKPINKYKLTANEGARIRRIHFGSFSCRIS
PETLQSMHGCSPTKSTRSHGDGEADPNISGSLAVSRGDVYNETALICLTN
MGDIMVLSVPELKRQLNAAAVRREDINGVSSLCFTNSGEALYMMSSSELQ
RIALATSRVVQPTGVVPVEPLENEESVLEENDAENNKETYACDEVVNTYE
IKNPSGISICTRPAEENVGRNSVQQVNGVNISNSPNQANETISSSIGDIT
VDSVRDHLNMTTTTLCSINTEETIGRLSVLSTQTNKASTTVNMSEIPNIN
ISNLEDLESKRNTTETSTSSVVIKSIITNISHEKTNGDNKIGTPKTAPEE
SQF*

RE31203.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)gl-PB 1153 CG2671-PB 1..1153 1..1153 5978 100 Plus
l(2)gl-PJ 1161 CG2671-PJ 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PI 1161 CG2671-PI 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PH 1161 CG2671-PH 1..1161 1..1153 5939 99.1 Plus
l(2)gl-PG 1161 CG2671-PG 1..1161 1..1153 5939 99.1 Plus