Clone RE32370 Report

Search the DGRC for RE32370

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:323
Well:70
Vector:pFlc-1
Associated Gene/TranscriptLmpt-RD
Protein status:RE32370.pep: gold
Sequenced Size:2872

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Lmpt-RD 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE32370.complete Sequence

2872 bp assembled on 2009-11-30

GenBank Submission: BT100317.1

> RE32370.complete
AGTTGGAATTGGTCTGCTTAACGGTGTGGTTGTCGGCGGCGGCGTTTATT
CCCCGCGATTTGCGCGCGATTCGCATGCGTTTTCCCAGTGGCAGCGCGAA
TCACCAAAGAAGAACCGACAAATTGTGCCGAGTCAGGCAATAAGAAAAGA
TATTTAAGCAGAAACCCACGAGAGCCAAGTCAAGTTCATTAAGACAAACG
GTAACAGTAATAGGAATAAAAAAAAAGAGAAGAAGCGAATATAAAGCCAA
AAACCCTTAGTTCAAAGTGCTGTTGAAAGTGGCGTAAAATGGTGAAAATG
CTCGATCTGGACCGTCACGCAGAGTGCCCACTGTGGGCGGCACTGGCCTC
CTCGGATGTCCCATGGACGGGAATGGACTACGCCTGCCTGAACGTGCTCA
GTATCTACTGCAAAGTATTCGATAGGAAGGAAATATACGATCTCATCGTG
AGGAAAACCTGCCAGTCCTGCAAATGTCCTCGCGAGGCGCATGCCATCTA
TCAGCAACAGACTACCAACGTGCATGAGCGACTCGGCTTCAAATTGGTCT
CTCCGGCGGATTCGGGAGTGGAGGCGCGGGATCTGGGCTTCACGTGGGTT
CCGCCCGGAGTGCGTGCCTCCTCGCGCATCAACCGCTACTTCGAGCAGCT
GCCCGACGAAATGGTACCCCGGCTGGGCAGCGAAGGCGCCTGCAGCCGGG
AGCGACAGATCTCTTACCAGCTGCCCAAACAGGACCTCTCGCTGGAGCAC
TGCAAGCACCTGGAGGTGCAGCACGAGGCTTCCTTCGAGGACTTTGTGAC
GGCGCGAAACGAAATCGCACTGGACATAGCCTACATCAAGGATGCCCCCT
ACGATGAGCATTGTGCGCACTGTGATAACGAGATAGCCGCCGGCGAGCTA
GTTGTGGCGGCGCCCAAGTTTGTGGAGAGCGTGATGTGGCACCCAAAGTG
CTTCACCTGCAGCACCTGCAACTCGCTACTCGTGGACCTCACCTACTGCG
TCCACGACGACAAGGTCTACTGCGAGCGCCACTATGCGGAAATGCTGAAG
CCCCGCTGCGCTGGCTGTGATGAGTTAATTTTCAGTGGCGAGTACACAAA
AGCCATGGACAAGGACTGGCACTCCGGACACTTCTGCTGCTGGCAATGCG
ACGAGAGCCTCACCGGACAGCGTTACGTCATCCGGGACGATCATCCGTAC
TGCATCAAGTGCTACGAGAATGTGTTCGCCAATACGTGCGAGGAGTGCAA
CAAGATCATTGGCATCGACTCCAAGGATCTGTCCTACAAAGACAAGCACT
GGCACGAGGCCTGTTTCCTGTGCTTCAAGTGCCATCTGTCGCTGGTGGAC
AAGCAGTTTGGAGCCAAGGCGGATAAGATCTACTGTGGAAACTGCTACGA
TGCCCAGTTTGCGTCCCGCTGCGATGGCTGCGGCGAAGTTTTCCGCGCAG
GCACCAAGAAAATGGAGTATAAAACCAGGCAGTGGCACGAGAATTGCTTC
TGCTGCTGCGTCTGCAAGACGGCCATTGGGACCAAGTCCTTCATCCCGCG
GGAGCAGGAGATCTATTGCGCCGGCTGCTACGAGGAGAAGTTTGCCACGC
GCTGCATCAAGTGCAATAAGGTCATCACCTCGGGAGGTGTTACCTACAAG
AACGAGCCGTGGCATCGCGAGTGCTTCACCTGCACCCACTGCAACATCAC
GCTAGCTGGCCAGCGATTCACCAGCCGCGACGAGAAGCCCTATTGTGCGG
AGTGCTTTGGCGAGCTCTTTGCCAAAAGGTGCACGGCCTGTGTGAAGCCC
ATAACAGGCATTGGCGGCACACGCTTCATATCGTTTGAGGATCGCCACTG
GCATCACGACTGCTTTGTGTGTGCCAGCTGCAAGGCTAGTCTGGTTGGTC
GTGGCTTCATCACCGACGGACCCGATATCCTGTGCCCCGATTGTGCCAAG
CAGAAGCTGATGTAAGGCGTCTGCAACGAGTCTGGATGTGGGAGAGCTGT
GGAGCAGCAAGCTTAAATTAGCCATAAACAAATTCAACGAAATTATGGAT
CAAATCAGAGGGATACTTACAAGTGGAAAACGATGAAGAGGAATATACAC
AGATGTATTAAACGATATACAAGAGATGATAATGCCTTACACTTACATTA
GATATGAGAAAATTAGCTGAAGCTGATGATGATGATAATGATGATGAGTC
CTACTAAATCAAAAGCAAATCAAATTTTGTAAACTTCAAGTCGATAGTGT
TAGCTAAAATCTATGGTAACTTTGCTTTATCTTCACGCGAGTAGAGCAGC
ACATCAGATTGTATAGAAACTTATTATTTGTAATTGCATTTCAGAACGAA
ATCAAAACCACTAAACAACAAAAAAAATGGAAAAACCCAAAAAAATCAAT
ATGAAATACTGATCCAATTGTAACTATTGTTGCCACATTGAAAGATGTAT
GTTTATTTATTTATTTTAAGTTTTAACCAAGCGACGAGCGAGTCGAACGC
GATGAAAGTTTCCTAACCGCTGGTTTCAGTTCTAAACAGTTCTATTGTAT
TAAAAACCACACACGATTTATGTTTGATATATATATATAGTAAATTATGT
TTATTAAACAGCAACACAAGGAACACACACGCACACAGACACAAGTCCTA
GCCATTGAATGAATTGTTTAGTTTATATTATTTTCGTTACGATCCCTTCG
TCCTTTTATCTATTTACCTATTTTAGAGACTCCGCTTACTTGAAGCACTA
AATACACACACACACACAAATAATAATGATAATTGCGACACAACATTATA
TCAATGTCCTTAACTATTTAATGAAATTCAATCTAAATAAATTAATAAAT
TATCAACTAAAAAAAAAAAAAA

RE32370.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-RD 2923 Lmpt-RD 16..2877 1..2862 14265 99.8 Plus
Lmpt-RH 2868 Lmpt-RH 8..2866 1..2862 14180 99.7 Plus
Lmpt.c 2803 Lmpt.c 25..2799 88..2862 13845 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16910874..16911919 1801..2856 4875 98.3 Plus
chr3L 24539361 chr3L 16886270..16886648 451..829 1850 99.2 Plus
chr3L 24539361 chr3L 16885703..16886068 88..453 1800 99.5 Plus
chr3L 24539361 chr3L 16886848..16887096 826..1074 1230 99.6 Plus
chr3L 24539361 chr3L 16901585..16901788 1073..1276 1020 100 Plus
chr3L 24539361 chr3L 16910622..16910811 1619..1808 950 100 Plus
chr3L 24539361 chr3L 16902671..16902848 1274..1451 890 100 Plus
chr3L 24539361 chr3L 16910323..16910497 1448..1622 815 97.7 Plus
chr3L 24539361 chr3L 16880719..16880807 1..89 415 97.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-RD 1677 CG42679-PD 1..1677 289..1965 8385 100 Plus
Lmpt-RH 1677 CG42679-PH 1..1677 289..1965 8385 100 Plus
Lmpt-RM 1680 CG42679-PM 165..1680 450..1965 7580 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:49:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-RD 2860 CG32171-RD 3..2859 1..2857 14255 99.9 Plus
Lmpt-RH 2804 CG32171-RH 206..2803 260..2857 12975 100 Plus
Lmpt-RM 2905 CG42679-RM 497..2904 450..2857 12025 100 Plus
Lmpt-RH 2804 CG32171-RH 3..206 1..200 910 97.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-PD 558 CG32171-PD 1..558 289..1962 3160 100 Plus
Lmpt-PH 558 CG32171-PH 1..558 289..1962 3160 100 Plus
Lmpt-PM 559 CG42679-PM 56..559 451..1962 2867 100 Plus
Lmpt-PN 529 CG42679-PN 26..529 451..1962 2867 100 Plus
Lmpt-PB 559 CG32171-PB 56..559 451..1962 2867 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16921430..16922491 1801..2862 5265 99.7 Plus
3L 28110227 3L 16896802..16897180 451..829 1895 100 Plus
3L 28110227 3L 16896235..16896600 88..453 1830 100 Plus
3L 28110227 3L 16897380..16897628 826..1074 1245 100 Plus
3L 28110227 3L 16912127..16912330 1073..1276 1020 100 Plus
3L 28110227 3L 16921178..16921367 1619..1808 950 100 Plus
3L 28110227 3L 16913222..16913399 1274..1451 890 100 Plus
3L 28110227 3L 16920879..16921053 1448..1622 875 100 Plus
3L 28110227 3L 16891228..16891316 1..89 430 98.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16914530..16915591 1801..2862 5265 99.7 Plus
3L 28103327 3L 16889902..16890280 451..829 1895 100 Plus
3L 28103327 3L 16889335..16889700 88..453 1830 100 Plus
3L 28103327 3L 16890480..16890728 826..1074 1245 100 Plus
3L 28103327 3L 16905227..16905430 1073..1276 1020 100 Plus
3L 28103327 3L 16914278..16914467 1619..1808 950 100 Plus
3L 28103327 3L 16906322..16906499 1274..1451 890 100 Plus
3L 28103327 3L 16913979..16914153 1448..1622 875 100 Plus
3L 28103327 3L 16884328..16884416 1..89 430 98.8 Plus
Blast to na_te.dros performed 2014-11-26 21:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 2885..2975 2744..2832 152 67.4 Plus

RE32370.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:40:26 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16910881..16911919 1808..2858 95   Plus
chr3L 16910624..16910810 1621..1807 100 -> Plus
chr3L 16910326..16910495 1451..1620 97 -> Plus
chr3L 16902673..16902847 1276..1450 100 -> Plus
chr3L 16901587..16901787 1075..1275 100 -> Plus
chr3L 16886852..16887096 830..1074 99 -> Plus
chr3L 16886272..16886648 453..829 99 -> Plus
chr3L 16885703..16886067 88..452 99 -> Plus
chr3L 16880719..16880805 1..87 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:20:24 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RD 1..1677 289..1965 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:25:41 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RD 1..1677 289..1965 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:34:18 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RH 1..1677 289..1965 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:40:26 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RH 1..1677 289..1965 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:20:23 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RD 1..2857 1..2858 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:25:41 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RD 1..2857 1..2858 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:34:18 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RD 3..2859 1..2858 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:26 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
Lmpt-RD 3..2859 1..2858 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:40:26 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16921437..16922486 1808..2858 99   Plus
3L 16921180..16921366 1621..1807 100 -> Plus
3L 16920882..16921051 1451..1620 100 -> Plus
3L 16913224..16913398 1276..1450 100 -> Plus
3L 16912129..16912329 1075..1275 100 -> Plus
3L 16897384..16897628 830..1074 100 -> Plus
3L 16896804..16897180 453..829 100 -> Plus
3L 16896235..16896599 88..452 100 -> Plus
3L 16891228..16891314 1..87 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:34:18 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16914537..16915586 1808..2858 99   Plus
arm_3L 16914280..16914466 1621..1807 100 -> Plus
arm_3L 16913982..16914151 1451..1620 100 -> Plus
arm_3L 16906324..16906498 1276..1450 100 -> Plus
arm_3L 16905229..16905429 1075..1275 100 -> Plus
arm_3L 16890484..16890728 830..1074 100 -> Plus
arm_3L 16889904..16890280 453..829 100 -> Plus
arm_3L 16889335..16889699 88..452 100 -> Plus
arm_3L 16884328..16884414 1..87 98 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:12:29 Download gff for RE32370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16914537..16915586 1808..2858 99   Plus
3L 16914280..16914466 1621..1807 100 -> Plus
3L 16913982..16914151 1451..1620 100 -> Plus
3L 16906324..16906498 1276..1450 100 -> Plus
3L 16905229..16905429 1075..1275 100 -> Plus
3L 16890484..16890728 830..1074 100 -> Plus
3L 16889904..16890280 453..829 100 -> Plus
3L 16889335..16889699 88..452 100 -> Plus
3L 16884328..16884414 1..87 98 -> Plus

RE32370.pep Sequence

Translation from 288 to 1964

> RE32370.pep
MVKMLDLDRHAECPLWAALASSDVPWTGMDYACLNVLSIYCKVFDRKEIY
DLIVRKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVEARDLG
FTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDL
SLEHCKHLEVQHEASFEDFVTARNEIALDIAYIKDAPYDEHCAHCDNEIA
AGELVVAAPKFVESVMWHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYA
EMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRD
DHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHL
SLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWH
ENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGG
VTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTA
CVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCP
DCAKQKLM*

RE32370.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23943-PA 338 GF23943-PA 46..338 266..558 1576 99.3 Plus
Dana\GF23942-PA 275 GF23942-PA 57..265 55..263 1088 96.2 Plus
Dana\GF12696-PA 799 GF12696-PA 127..415 79..366 587 38.6 Plus
Dana\GF23943-PA 338 GF23943-PA 57..332 217..489 445 33.1 Plus
Dana\GF11783-PA 817 GF11783-PA 628..807 192..366 400 43.9 Plus
Dana\GF23943-PA 338 GF23943-PA 118..337 217..435 373 34.8 Plus
Dana\GF12702-PA 1137 GF12702-PA 550..724 101..276 327 38.6 Plus
Dana\GF12696-PA 799 GF12696-PA 264..415 399..549 241 35.7 Plus
Dana\GF12696-PA 799 GF12696-PA 239..416 257..428 234 31.3 Plus
Dana\GF12696-PA 799 GF12696-PA 264..416 338..487 207 31.8 Plus
Dana\GF11783-PA 817 GF11783-PA 653..798 399..540 179 31.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13591-PA 339 GG13591-PA 47..339 266..558 1581 99.7 Plus
Dere\GG13588-PA 342 GG13588-PA 56..264 55..263 1100 98.6 Plus
Dere\GG23258-PA 798 GG23258-PA 144..432 79..366 585 38.6 Plus
Dere\GG23268-PA 1326 GG23268-PA 557..840 101..382 584 38.9 Plus
Dere\GG13591-PA 339 GG13591-PA 58..333 217..489 447 33.1 Plus
Dere\GG22194-PA 816 GG22194-PA 614..806 179..366 406 42.5 Plus
Dere\GG13591-PA 339 GG13591-PA 119..338 217..435 373 34.8 Plus
Dere\GG23268-PA 1326 GG23268-PA 629..815 360..541 271 33.2 Plus
Dere\GG23258-PA 798 GG23258-PA 281..432 399..549 242 35.7 Plus
Dere\GG23268-PA 1326 GG23268-PA 647..824 257..428 240 31.3 Plus
Dere\GG23258-PA 798 GG23258-PA 256..479 257..484 237 29 Plus
Dere\GG23268-PA 1326 GG23268-PA 642..824 312..487 223 30.6 Plus
Dere\GG23258-PA 798 GG23258-PA 281..433 338..487 208 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16603-PA 335 GH16603-PA 43..335 266..558 1563 98 Plus
Dgri\GH16600-PA 273 GH16600-PA 55..259 59..263 1038 93.7 Plus
Dgri\GH21516-PA 793 GH21516-PA 124..412 79..366 585 38.3 Plus
Dgri\GH21524-PA 1361 GH21524-PA 570..853 101..382 578 38.9 Plus
Dgri\GH16603-PA 335 GH16603-PA 39..329 197..489 458 32.6 Plus
Dgri\GH20485-PA 831 GH20485-PA 614..820 166..366 396 39.1 Plus
Dgri\GH16603-PA 335 GH16603-PA 115..334 217..435 377 35.3 Plus
Dgri\GH21524-PA 1361 GH21524-PA 642..828 360..541 278 33.7 Plus
Dgri\GH21524-PA 1361 GH21524-PA 660..837 257..428 243 32.4 Plus
Dgri\GH21516-PA 793 GH21516-PA 261..412 399..549 241 35.7 Plus
Dgri\GH21516-PA 793 GH21516-PA 236..413 257..428 237 31.3 Plus
Dgri\GH21524-PA 1361 GH21524-PA 655..837 312..487 217 30.1 Plus
Dgri\GH21516-PA 793 GH21516-PA 261..413 338..487 210 31.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-PD 558 CG32171-PD 1..558 1..558 3160 100 Plus
Lmpt-PH 558 CG32171-PH 1..558 1..558 3160 100 Plus
Lmpt-PM 559 CG42679-PM 56..559 55..558 2867 100 Plus
Lmpt-PN 529 CG42679-PN 26..529 55..558 2867 100 Plus
Lmpt-PB 559 CG32171-PB 56..559 55..558 2867 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12449-PA 335 GI12449-PA 43..335 266..558 1566 98.3 Plus
Dmoj\GI12446-PA 335 GI12446-PA 55..263 55..263 1030 90.4 Plus
Dmoj\GI19485-PA 837 GI19485-PA 169..457 79..366 590 38.6 Plus
Dmoj\GI19495-PA 968 GI19495-PA 198..481 101..382 578 38.9 Plus
Dmoj\GI12449-PA 335 GI12449-PA 39..329 197..489 456 32.6 Plus
Dmoj\GI21028-PA 836 GI21028-PA 646..825 192..366 393 43.9 Plus
Dmoj\GI12449-PA 335 GI12449-PA 115..334 217..435 376 35.3 Plus
Dmoj\GI19495-PA 968 GI19495-PA 270..464 360..549 280 33.3 Plus
Dmoj\GI19495-PA 968 GI19495-PA 288..465 257..428 245 32.4 Plus
Dmoj\GI19485-PA 837 GI19485-PA 281..457 378..549 240 33.9 Plus
Dmoj\GI19485-PA 837 GI19485-PA 281..458 257..428 236 31.3 Plus
Dmoj\GI19495-PA 968 GI19495-PA 285..465 314..487 219 30.4 Plus
Dmoj\GI19485-PA 837 GI19485-PA 306..458 338..487 208 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20860-PA 340 GL20860-PA 48..340 266..558 1579 99.3 Plus
Dper\GL11157-PA 987 GL11157-PA 204..487 101..382 578 38.9 Plus
Dper\GL20860-PA 340 GL20860-PA 59..334 217..489 449 33.1 Plus
Dper\GL10662-PA 816 GL10662-PA 626..806 191..366 404 43.1 Plus
Dper\GL20860-PA 340 GL20860-PA 120..339 217..435 373 34.8 Plus
Dper\GL21108-PA 639 GL21108-PA 388..639 257..495 309 31.9 Plus
Dper\GL11157-PA 987 GL11157-PA 276..470 360..549 277 33.3 Plus
Dper\GL24193-PA 348 GL24193-PA 20..325 191..490 257 25.4 Plus
Dper\GL21108-PA 639 GL21108-PA 405..544 397..540 253 36.1 Plus
Dper\GL11157-PA 987 GL11157-PA 294..471 257..428 241 31.8 Plus
Dper\GL21108-PA 639 GL21108-PA 388..616 317..535 231 30.5 Plus
Dper\GL11157-PA 987 GL11157-PA 289..471 312..487 223 30.6 Plus
Dper\GL10662-PA 816 GL10662-PA 625..797 364..540 197 32.6 Plus
Dper\GL10662-PA 816 GL10662-PA 620..807 310..487 183 28.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28580-PA 340 GA28580-PA 48..340 266..558 1579 99.3 Plus
Dpse\GA28578-PA 352 GA28578-PA 56..264 55..263 1090 96.7 Plus
Dpse\GA11840-PA 795 GA11840-PA 132..420 79..366 587 38.6 Plus
Dpse\GA10748-PA 1353 GA10748-PA 567..850 101..382 578 38.9 Plus
Dpse\GA28580-PA 340 GA28580-PA 59..334 217..489 449 33.1 Plus
Dpse\GA19661-PA 816 GA19661-PA 626..806 191..366 403 43.1 Plus
Dpse\GA28580-PA 340 GA28580-PA 120..339 217..435 373 34.8 Plus
Dpse\GA10748-PA 1353 GA10748-PA 639..825 360..541 278 33.7 Plus
Dpse\GA11840-PA 795 GA11840-PA 269..420 399..549 241 35.7 Plus
Dpse\GA10748-PA 1353 GA10748-PA 657..834 257..428 240 31.8 Plus
Dpse\GA11840-PA 795 GA11840-PA 244..466 257..483 237 29.4 Plus
Dpse\GA10748-PA 1353 GA10748-PA 652..834 312..487 222 30.6 Plus
Dpse\GA11840-PA 795 GA11840-PA 269..421 338..487 214 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25674-PA 339 GM25674-PA 47..339 266..558 1581 99.7 Plus
Dsec\GM25671-PA 333 GM25671-PA 1..271 1..270 1411 97.8 Plus
Dsec\GM20940-PA 1302 GM20940-PA 538..821 101..382 590 39.3 Plus
Dsec\GM20932-PA 785 GM20932-PA 131..419 79..366 586 38.6 Plus
Dsec\GM25674-PA 339 GM25674-PA 58..333 217..489 447 33.1 Plus
Dsec\GM19980-PA 816 GM19980-PA 627..806 192..366 402 42.8 Plus
Dsec\GM25674-PA 339 GM25674-PA 119..338 217..435 373 34.8 Plus
Dsec\GM20940-PA 1302 GM20940-PA 610..796 360..541 270 32.6 Plus
Dsec\GM20940-PA 1302 GM20940-PA 628..805 257..428 244 31.8 Plus
Dsec\GM20932-PA 785 GM20932-PA 268..419 399..549 242 35.7 Plus
Dsec\GM20932-PA 785 GM20932-PA 243..466 257..484 236 29.2 Plus
Dsec\GM20940-PA 1302 GM20940-PA 623..805 312..487 227 31.2 Plus
Dsec\GM20932-PA 785 GM20932-PA 268..420 338..487 208 31.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14678-PA 339 GD14678-PA 47..339 266..558 1581 99.7 Plus
Dsim\GD10458-PA 786 GD10458-PA 132..420 79..366 586 38.6 Plus
Dsim\GD14676-PA 182 GD14676-PA 5..120 156..270 578 94.8 Plus
Dsim\GD14678-PA 339 GD14678-PA 58..333 217..489 447 33.1 Plus
Dsim\GD25476-PA 816 GD25476-PA 614..806 179..366 401 42 Plus
Dsim\GD14678-PA 339 GD14678-PA 119..338 217..435 373 34.8 Plus
Dsim\GD10467-PA 179 GD10467-PA 20..177 101..259 322 39.6 Plus
Dsim\GD10458-PA 786 GD10458-PA 269..420 399..549 242 35.7 Plus
Dsim\GD10458-PA 786 GD10458-PA 244..467 257..484 236 29.2 Plus
Dsim\GD10458-PA 786 GD10458-PA 269..421 338..487 207 31.8 Plus
Dsim\GD25476-PA 816 GD25476-PA 625..797 364..540 173 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12349-PA 335 GJ12349-PA 43..335 266..558 1562 98 Plus
Dvir\GJ12345-PA 289 GJ12345-PA 55..263 55..263 1056 92.8 Plus
Dvir\GJ15146-PA 856 GJ15146-PA 183..471 79..366 587 38.3 Plus
Dvir\GJ15157-PA 1421 GJ15157-PA 618..901 101..382 577 38.9 Plus
Dvir\GJ12349-PA 335 GJ12349-PA 54..329 217..489 447 32.7 Plus
Dvir\GJ21955-PA 830 GJ21955-PA 640..819 192..366 393 43.3 Plus
Dvir\GJ12349-PA 335 GJ12349-PA 115..334 217..435 377 35.3 Plus
Dvir\GJ15157-PA 1421 GJ15157-PA 690..884 360..549 279 33.3 Plus
Dvir\GJ15157-PA 1421 GJ15157-PA 708..885 257..428 243 32.4 Plus
Dvir\GJ15146-PA 856 GJ15146-PA 320..471 399..549 241 35.7 Plus
Dvir\GJ15146-PA 856 GJ15146-PA 295..472 257..428 236 31.3 Plus
Dvir\GJ15157-PA 1421 GJ15157-PA 705..885 314..487 217 30.4 Plus
Dvir\GJ15146-PA 856 GJ15146-PA 320..472 338..487 209 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20916-PA 337 GK20916-PA 45..337 266..558 1565 98.6 Plus
Dwil\GK20905-PA 325 GK20905-PA 56..307 55..306 1057 78 Plus
Dwil\GK21790-PA 779 GK21790-PA 157..423 101..366 582 40.3 Plus
Dwil\GK21795-PA 1368 GK21795-PA 577..860 101..382 577 38.9 Plus
Dwil\GK20916-PA 337 GK20916-PA 56..331 217..489 455 33.5 Plus
Dwil\GK23303-PA 807 GK23303-PA 601..797 175..366 388 40.1 Plus
Dwil\GK20916-PA 337 GK20916-PA 117..336 217..435 369 34.8 Plus
Dwil\GK21795-PA 1368 GK21795-PA 649..835 360..541 277 33.7 Plus
Dwil\GK21790-PA 779 GK21790-PA 272..423 399..549 244 35.7 Plus
Dwil\GK21795-PA 1368 GK21795-PA 667..844 257..428 237 31.8 Plus
Dwil\GK21790-PA 779 GK21790-PA 247..424 257..428 235 31.7 Plus
Dwil\GK21795-PA 1368 GK21795-PA 662..844 312..487 218 30.6 Plus
Dwil\GK21790-PA 779 GK21790-PA 272..424 338..487 201 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19888-PA 339 GE19888-PA 47..339 266..558 1581 99.7 Plus
Dyak\GE19885-PA 284 GE19885-PA 56..264 55..263 1104 98.1 Plus
Dyak\GE19108-PA 789 GE19108-PA 133..421 79..366 587 38.6 Plus
Dyak\GE19116-PA 1308 GE19116-PA 537..820 101..382 584 38.9 Plus
Dyak\GE19888-PA 339 GE19888-PA 58..333 217..489 447 33.1 Plus
Dyak\GE14189-PA 816 GE14189-PA 614..806 179..366 405 42 Plus
Dyak\GE19888-PA 339 GE19888-PA 119..338 217..435 373 34.8 Plus
Dyak\GE19116-PA 1308 GE19116-PA 609..795 360..541 271 33.2 Plus
Dyak\GE19108-PA 789 GE19108-PA 270..421 399..549 243 35.7 Plus
Dyak\GE19116-PA 1308 GE19116-PA 627..804 257..428 240 31.3 Plus
Dyak\GE19108-PA 789 GE19108-PA 245..422 257..428 236 31.3 Plus
Dyak\GE19116-PA 1308 GE19116-PA 624..804 314..487 223 31 Plus
Dyak\GE19108-PA 789 GE19108-PA 270..422 338..487 209 31.8 Plus

RE32370.hyp Sequence

Translation from 288 to 1964

> RE32370.hyp
MVKMLDLDRHAECPLWAALASSDVPWTGMDYACLNVLSIYCKVFDRKEIY
DLIVRKTCQSCKCPREAHAIYQQQTTNVHERLGFKLVSPADSGVEARDLG
FTWVPPGVRASSRINRYFEQLPDEMVPRLGSEGACSRERQISYQLPKQDL
SLEHCKHLEVQHEASFEDFVTARNEIALDIAYIKDAPYDEHCAHCDNEIA
AGELVVAAPKFVESVMWHPKCFTCSTCNSLLVDLTYCVHDDKVYCERHYA
EMLKPRCAGCDELIFSGEYTKAMDKDWHSGHFCCWQCDESLTGQRYVIRD
DHPYCIKCYENVFANTCEECNKIIGIDSKDLSYKDKHWHEACFLCFKCHL
SLVDKQFGAKADKIYCGNCYDAQFASRCDGCGEVFRAGTKKMEYKTRQWH
ENCFCCCVCKTAIGTKSFIPREQEIYCAGCYEEKFATRCIKCNKVITSGG
VTYKNEPWHRECFTCTHCNITLAGQRFTSRDEKPYCAECFGELFAKRCTA
CVKPITGIGGTRFISFEDRHWHHDCFVCASCKASLVGRGFITDGPDILCP
DCAKQKLM*

RE32370.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
Lmpt-PD 558 CG32171-PD 1..558 1..558 3160 100 Plus
Lmpt-PH 558 CG32171-PH 1..558 1..558 3160 100 Plus
Lmpt-PM 559 CG42679-PM 56..559 55..558 2867 100 Plus
Lmpt-PN 529 CG42679-PN 26..529 55..558 2867 100 Plus
Lmpt-PB 559 CG32171-PB 56..559 55..558 2867 100 Plus