Clone RE34447 Report

Search the DGRC for RE34447

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:344
Well:47
Vector:pFlc-1
Associated Gene/TranscriptCG5059-RB
Protein status:RE34447.pep: gold
Sequenced Size:1349

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5059-RB 2010-01-14 Manual selection by Sue Celniker

Clone Sequence Records

RE34447.complete Sequence

1349 bp assembled on 2010-02-12

GenBank Submission: BT120333.1

> RE34447.complete
AGTATTCAATTGTCAGCATGATTGGTGTGCCACAATCTTGGATCGAACTC
AGCACAACAGCTGCGATGGCTGGCATCAAGAGCCCCGACAGAATCACTCC
GTTGCCATTCAACAATGGCGAGGAGTACCTGAGACTTCTGCGCGAGGCCC
AGCGCGAGTCGAACCAGTCGAGCCGTGTCGTCTCCTTGGCCAGCTCCCGT
CGTGATACGCCCCGTGATAGCCCCAAGAGTCCACCGAACAGTCCCCAGTC
GGAGCTCTGTCCGGATGATGAGCTCAGAAACGTGTACATCAACTACTGGA
CCAAGGGAGGAGACAAACAGAATGCAGGCAATGAAGATTGGCTGAAGAAC
TGGAATCAGCCACCCAGTAGCTGGAACATTGAGGATTCAAGTCGGGATGC
CGGCGACGAGGGCGAGAAAAAGAAGACTAACACAGGCTACTCCATCCGTT
TGAAGCGACTGGGCTCCAACTCGTTGTTCTCCCGCGAAATTCTGTACTCG
CTGCTGGTGACCAACGTCCTGTCCCTGCTGCTGGGAGCTGGATTCGGGCT
ATGGTTGAGCAAGCGTGGCATACTCCTTACCCGTGTGGTCATTGACTGAA
AGATGCCATAAACAAAAAGGAGAAAGAGGAAATATATATAATCGTTTTCA
ATCTATCAATATGCACATCAATCGAAAACAGAACACGATGCGTTCCATAT
AAGAAAACGAAGTATACACATCTATACAGCCAACCGTATTCCAACTCATT
TGTATTTTTATCGGAAGTCTATATTTTCGACACCTTCTCATTCAGTACAT
ACCTATAAAAATGTAATTTCTAATTACTAAGCCAGCAAACTAAAACAGGC
CTTTGGGCAATGGTTGAAACTAAGCGTTTTCATATTTTATATAATTTTAT
ATATTTAACATTATATCAAGGCAGCAAATCTAATGATACAGAAAAGCATT
TATAGATGCTCCATATATTTTGCTTTAGCCGTATGTCTTAGCACCCAACC
GTGCATTATATCCAATACAAATGTACGCCGAACTTCGTGTTAAGAATTTC
AATTTCATCATCATACATCATATAGAACAACCATAAACATTTGTAGACAT
ATTATAGTTGAATCGTATTGTATCCTGATTGTACTTTTTGTTGAACAATC
GTCAAATGTTTCGATACAATAAGCATATAAGAAAAACGATACAAAAGGAG
AAAAAAAAACAATATGGCACACATAAGATTATATCTTTAATGTGAGGGAA
GGGTTATCCCCCACACAAAAAAAACAGAATAGTTGTAATGATTTTTTATA
TTAAAATATTTTTCAATATCTATTTAAAAGAGTAAAAAAAAAAAAAAAA

RE34447.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059.c 1800 CG5059.c 388..1719 1..1332 6660 100 Plus
CG5059-RB 1450 CG5059-RB 38..1369 1..1332 6660 100 Plus
CG5059-RC 2005 CG5059-RC 624..1924 32..1332 6505 100 Plus
CG5059-RC 2005 CG5059-RC 31..63 1..33 165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20503589..20504374 1332..547 3915 99.9 Minus
chr3L 24539361 chr3L 20504843..20505126 313..30 1375 98.9 Minus
chr3L 24539361 chr3L 20504433..20504616 548..365 920 100 Minus
chr3L 24539361 chr3L 20504715..20504778 367..304 320 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-RB 582 CG5059-PB 1..582 18..599 2910 100 Plus
CG5059-RA 606 CG5059-PA 41..606 34..599 2830 100 Plus
CG5059-RE 534 CG5059-PE 1..534 66..599 2670 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-RB 1344 CG5059-RB 12..1343 1..1332 6660 100 Plus
CG5059-RC 1905 CG5059-RC 605..1905 32..1332 6505 100 Plus
CG5059-RE 1543 CG5059-RE 243..1542 33..1332 6500 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-PB 193 CG5059-PB 1..193 18..596 851 100 Plus
CG5059-PA 201 CG5059-PA 14..201 33..596 822 99.5 Plus
CG5059-PE 177 CG5059-PE 1..177 66..596 770 100 Plus
CG5059-PD 177 CG5059-PD 1..177 66..596 770 100 Plus
CG5059-PC 177 CG5059-PC 1..177 66..596 770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20514599..20515384 1332..547 3930 100 Minus
3L 28110227 3L 20515853..20516136 313..30 1375 98.9 Minus
3L 28110227 3L 20515443..20515626 548..365 920 100 Minus
3L 28110227 3L 20515725..20515788 367..304 320 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20507699..20508484 1332..547 3930 100 Minus
3L 28103327 3L 20508953..20509236 313..30 1375 98.9 Minus
3L 28103327 3L 20508543..20508726 548..365 920 100 Minus
3L 28103327 3L 20508825..20508888 367..304 320 100 Minus
3L 28103327 3L 20510361..20510393 33..1 165 100 Minus
Blast to na_te.dros performed 2014-11-26 20:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 1913..1957 661..704 114 75.6 Plus

RE34447.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:27:17 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20506251..20506283 1..33 100   Minus
chr3L 20504851..20505122 34..305 100 <- Minus
chr3L 20504715..20504776 306..367 100 <- Minus
chr3L 20504434..20504613 368..547 100 <- Minus
chr3L 20503588..20504373 548..1333 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-12 09:36:36 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 1..582 18..599 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:28:00 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 1..582 18..599 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:02:57 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 1..582 18..599 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:17 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 1..582 18..599 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-12 09:36:36 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 1..1332 1..1333 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:28:00 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 1..1332 1..1333 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:02:57 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 12..1343 1..1333 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:17 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
CG5059-RB 12..1343 1..1333 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:27:17 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20517261..20517293 1..33 100   Minus
3L 20515861..20516132 34..305 100 <- Minus
3L 20515725..20515786 306..367 100 <- Minus
3L 20515444..20515623 368..547 100 <- Minus
3L 20514598..20515383 548..1333 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:02:57 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20510361..20510393 1..33 100   Minus
arm_3L 20508961..20509232 34..305 100 <- Minus
arm_3L 20508825..20508886 306..367 100 <- Minus
arm_3L 20508544..20508723 368..547 100 <- Minus
arm_3L 20507698..20508483 548..1333 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:14:03 Download gff for RE34447.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20510361..20510393 1..33 100   Minus
3L 20508961..20509232 34..305 100 <- Minus
3L 20508825..20508886 306..367 100 <- Minus
3L 20508544..20508723 368..547 100 <- Minus
3L 20507698..20508483 548..1333 99 <- Minus

RE34447.pep Sequence

Translation from 2 to 598

> RE34447.pep
YSIVSMIGVPQSWIELSTTAAMAGIKSPDRITPLPFNNGEEYLRLLREAQ
RESNQSSRVVSLASSRRDTPRDSPKSPPNSPQSELCPDDELRNVYINYWT
KGGDKQNAGNEDWLKNWNQPPSSWNIEDSSRDAGDEGEKKKTNTGYSIRL
KRLGSNSLFSREILYSLLVTNVLSLLLGAGFGLWLSKRGILLTRVVID*

RE34447.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24126-PA 208 GF24126-PA 14..208 11..198 887 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13304-PA 206 GG13304-PA 14..206 11..198 890 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17012-PA 203 GH17012-PA 14..203 11..198 819 85 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-PB 193 CG5059-PB 1..193 6..198 1008 100 Plus
CG5059-PA 201 CG5059-PA 14..201 11..198 979 99.5 Plus
CG5059-PE 177 CG5059-PE 1..177 22..198 927 100 Plus
CG5059-PD 177 CG5059-PD 1..177 22..198 927 100 Plus
CG5059-PC 177 CG5059-PC 1..177 22..198 927 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11906-PA 203 GI11906-PA 14..203 11..198 792 83.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12771-PA 205 GL12771-PA 14..205 11..198 832 85 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18627-PA 205 GA18627-PA 14..205 11..198 784 85 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22205-PA 206 GM22205-PA 14..206 11..198 913 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12180-PA 206 GD12180-PA 14..206 11..198 913 93.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13780-PA 202 GJ13780-PA 14..202 11..198 823 85 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12337-PA 209 GK12337-PA 14..209 11..198 807 82.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22394-PA 206 GE22394-PA 14..206 11..198 896 91.7 Plus
Dyak\GE22740-PA 206 GE22740-PA 14..206 11..198 896 91.7 Plus

RE34447.hyp Sequence

Translation from 2 to 598

> RE34447.hyp
YSIVSMIGVPQSWIELSTTAAMAGIKSPDRITPLPFNNGEEYLRLLREAQ
RESNQSSRVVSLASSRRDTPRDSPKSPPNSPQSELCPDDELRNVYINYWT
KGGDKQNAGNEDWLKNWNQPPSSWNIEDSSRDAGDEGEKKKTNTGYSIRL
KRLGSNSLFSREILYSLLVTNVLSLLLGAGFGLWLSKRGILLTRVVID*

RE34447.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5059-PB 193 CG5059-PB 1..193 6..198 1008 100 Plus
CG5059-PA 201 CG5059-PA 14..201 11..198 979 99.5 Plus
CG5059-PE 177 CG5059-PE 1..177 22..198 927 100 Plus
CG5059-PD 177 CG5059-PD 1..177 22..198 927 100 Plus
CG5059-PC 177 CG5059-PC 1..177 22..198 927 100 Plus