Clone RE34964 Report

Search the DGRC for RE34964

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:349
Well:64
Vector:pFlc-1
Associated Gene/TranscriptCyp6a19-RA
Protein status:RE34964.pep: gold
Sequenced Size:1708

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Cyp6a19 2008-04-29 Picked prior to 5.5
Cyp6a19 2008-12-18 5.12 accounting

Clone Sequence Records

RE34964.complete Sequence

1708 bp assembled on 2008-11-04

GenBank Submission: BT050551.1

> RE34964.complete
AGTCTGCTCAAAATGGCGATCCTGCTCGGTTTGGTGGTCGGTGTCCTTAC
GCTCGTCGCTTGGTGGGTGCTCCAGAACTACACCTACTGGAAACGGCGAG
GAATTCCCCATGATCCACCCAATATTCCGCTCGGCAATACCGGCGAACTT
TGGAGAACAATGCCGCTGGCCGGCATCCTCAAGCGAACATATCTGAAATT
CAGGAAACAGACCGACGGACCTTTTGCGGGCTTCTACCTCTATGCTATGA
AGTACATTGTCATCACGGACGTGGATTTTGTAAAAACCGTGCTAATTCGC
GACTTCGATAAGTTTCACGATCGCGGAGTGTATCACAACGAAAAGGATGA
TCCGCTGACCAATAACCTGGCAACCATCGAGGGTCAAAAGTGGAAAAATC
TGCGACAGAAGCTGACCCACACATTTACGTCAGCCAAAATGAAGAGCATG
TTTTCCACGGTCTTAAACGTGGGCGATGAGATGATTCGCGTGGTCGATGA
AAAGATCTCCAGTTCTTCGCAGACCCTGGAAGTCACCGACATTGTGTCAC
GCTTCACATCCGACGTAATTGGAATCTGTGCTTTTGGCCTGAAATGCAAT
AGTCTGCGGGATCCTAAGGCGGAGTTCGTCCAAATGGGCTACTCAGCGCT
AAGAGAACGTCGTCATGGTTGGCTGGTAGATCTACTAATCTTCGGGATGC
CTAAACTGGCCGTGAAACTGGGTTTCCAGTTCTTGCTTCCCTCGGTGCAG
AAGTTCTATATGAAAATCGTGCAGGACACCATAGATTACAGGATGAAGAG
AAAGGTGACTCGGAACGATTTCATGGACACGTTGATTGACATGAAACAGC
AGTATGATAAAGGCGACAAGGAAAATGGACTTGCCTTCAATGAGGTCGCT
GCCCAGGCCTTCGTATTTTTCCTAGCTGGTTTTGAGGCGGGATCCACAAC
CATGGGATTCACACTTTATGAGCTGGCCTGCAATCAGGATGTTCAGGACA
AGTTGAGGGCTGAAATCGACAGTGTGCTGGAAAGGTACAATGGTAAACTG
GAATACGATTCTATGCAGGACTTGTTTTATATGGAAAAGGTTATCAATGA
ATCGCTAAGGAAACATCCAGTGGTAGCCCACTTGGCTCGCATTGCCACCA
AACCGTACCAGCACAGTAATCCCAAGTATTTCATAGAGGCCGGCACTGGA
GTGCTGGTGTCCACCCTGGGCATCCATCATGATCCTGAGTTTTATCCGGA
GCCGGAAAAGTTTATCCCAGAACGATTCGATGAAGAGCAAGTAAAGAAGC
GTCCCACCTGCGCTTTCCTACCCTTCGGAGCTGGTCCCCGAAATTGCATT
GGACTCCGATTCGGACGGATGCAGGTCATCATTGGATTGGCCCTGCTAAT
CCACAATTTTAGGTTCGAATTGCATCCCAAGACGCCAGTGCCAATGAAAT
ACACAATCAATAACCTTTTGCTGGGCTCCGAGGGCGGAATCCATCTCAAT
ATCACCAAGGTAGTGAGAGACTAAAGTGTTATATATTTATTTAATTTCGT
TGTTAGTTACTTTGAGTACGTGATTTTTAAAATGTTTTTGTAATGATTTT
AAAATATCTTAACTTCTTAAAAATGTTATGTTCATAGATTGCTTCTGCCA
AGAAATGCCGAAAGTATTTTTTCTGCAAAAGAGTCTTGTAATAAAAAAAA
AAAAAAAA

RE34964.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-RA 1988 Cyp6a19-RA 75..1768 1..1694 8470 100 Plus
Cyp6a19.a 1886 Cyp6a19.a 1..1084 16..1099 5420 100 Plus
Cyp6a19.a 1886 Cyp6a19.a 1084..1669 1109..1694 2930 100 Plus
CG10245.a 1999 CG10245.a 1355..1628 1156..1429 425 77 Plus
CG10245.a 1999 CG10245.a 1014..1197 815..998 395 80.9 Plus
CG10245.a 1999 CG10245.a 485..678 286..479 310 77.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10765111..10766209 1..1099 5450 99.7 Plus
chr2R 21145070 chr2R 10766278..10766871 1099..1692 2925 99.5 Plus
chr2R 21145070 chr2R 10770741..10771014 1156..1429 425 77 Plus
chr2R 21145070 chr2R 10770272..10770455 815..998 395 81 Plus
chr2R 21145070 chr2R 10769743..10769936 286..479 310 77.3 Plus
chr2R 21145070 chr2R 10762194..10762288 904..998 220 82.1 Plus
chr2R 21145070 chr2R 10761662..10761740 375..453 185 82.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-RA 1512 CG10243-PA 1..1512 13..1524 7560 100 Plus
Cyp6a19-RB 1104 CG10243-PB 1..1087 13..1099 5435 100 Plus
Cyp6a20-RB 1505 CG10245-PB 802..1416 815..1429 735 74.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-RA 1694 CG10243-RA 3..1694 1..1692 8460 100 Plus
Cyp6a19-RB 1903 CG10243-RB 3..1684 1..1692 8275 99.4 Plus
Cyp6a9-RB 1964 CG10246-RB 1787..1964 1692..1515 890 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-PA 503 CG10243-PA 21..503 73..1521 2547 100 Plus
Cyp6a20-PB 501 CG10245-PB 21..501 73..1512 1798 66.9 Plus
Cyp6a19-PB 367 CG10243-PB 21..366 73..1110 1794 98.8 Plus
Cyp6a23-PA 502 CG10242-PA 21..500 73..1512 1347 51.1 Plus
Cyp6a17-PB 501 CG10241-PB 20..501 73..1518 1343 51.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14877788..14878886 1..1099 5495 100 Plus
2R 25286936 2R 14878940..14879535 1099..1694 2980 100 Plus
2R 25286936 2R 14883402..14883675 1156..1429 425 77 Plus
2R 25286936 2R 14882933..14883116 815..998 395 81 Plus
2R 25286936 2R 14882404..14882597 286..479 310 77.3 Plus
2R 25286936 2R 14874868..14874962 904..998 220 82.1 Plus
2R 25286936 2R 14874336..14874414 375..453 185 82.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14878987..14880085 1..1099 5495 100 Plus
2R 25260384 2R 14880139..14880734 1099..1694 2980 100 Plus
2R 25260384 2R 14884601..14884874 1156..1429 425 77 Plus
2R 25260384 2R 14884132..14884315 815..998 395 80.9 Plus
2R 25260384 2R 14883603..14883796 286..479 310 77.3 Plus
2R 25260384 2R 14876067..14876161 904..998 220 82.1 Plus
2R 25260384 2R 14875535..14875613 375..453 185 82.2 Plus
2R 25260384 2R 14877419..14877497 375..453 170 81 Plus
Blast to na_te.dros performed 2014-11-27 03:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker2 7672 Stalker2 STALKER2 7672bp 1316..1399 1618..1532 122 62.1 Minus

RE34964.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:55:29 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10766279..10766871 1100..1692 99   Plus
chr2R 10765111..10766209 1..1099 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:30 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 1..1512 13..1524 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:18 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 1..1512 13..1524 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:17 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 1..1512 13..1524 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:29 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 1..1512 13..1524 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:39 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 1..1692 1..1692 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:18 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 1..1692 1..1692 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:17 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 3..1694 1..1692 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:10:05 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 1..1692 1..1692 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:29 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp6a19-RA 3..1694 1..1692 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:55:29 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14878941..14879533 1100..1692 100   Plus
2R 14877788..14878886 1..1099 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:17 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10766446..10767038 1100..1692 100   Plus
arm_2R 10765293..10766391 1..1099 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:30 Download gff for RE34964.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14880140..14880732 1100..1692 100   Plus
2R 14878987..14880085 1..1099 100 -> Plus

RE34964.pep Sequence

Translation from 0 to 1523

> RE34964.pep
SLLKMAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNTGEL
WRTMPLAGILKRTYLKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVLIR
DFDKFHDRGVYHNEKDDPLTNNLATIEGQKWKNLRQKLTHTFTSAKMKSM
FSTVLNVGDEMIRVVDEKISSSSQTLEVTDIVSRFTSDVIGICAFGLKCN
SLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQFLLPSVQ
KFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVA
AQAFVFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKL
EYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPKYFIEAGTG
VLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCI
GLRFGRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLLGSEGGIHLN
ITKVVRD*

RE34964.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 18:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12303-PA 501 GF12303-PA 1..501 5..504 1959 68.7 Plus
Dana\GF12301-PA 500 GF12301-PA 1..498 5..504 1450 52.8 Plus
Dana\GF12302-PA 502 GF12302-PA 1..502 5..506 1448 52.5 Plus
Dana\GF12300-PA 502 GF12300-PA 30..502 34..506 1366 53.8 Plus
Dana\GF12635-PA 508 GF12635-PA 6..506 7..504 1250 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 18:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20489-PA 504 GG20489-PA 1..501 5..504 1916 66.1 Plus
Dere\GG20488-PA 501 GG20488-PA 14..501 19..506 1379 51.7 Plus
Dere\GG22385-PA 510 GG22385-PA 6..506 7..504 1216 47.7 Plus
Dere\GG20487-PA 499 GG20487-PA 8..494 7..504 1192 46.6 Plus
Dere\GG10797-PA 506 GG10797-PA 1..506 5..504 1169 43.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 18:52:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21101-PA 500 GH21101-PA 1..498 5..504 1361 51 Plus
Dgri\GH20135-PA 506 GH20135-PA 1..506 5..504 1210 46.5 Plus
Dgri\GH21100-PA 497 GH21100-PA 1..494 5..504 1188 45.8 Plus
Dgri\GH21102-PA 498 GH21102-PA 1..488 5..494 1177 45.3 Plus
Dgri\Cyp6a9-PA 504 GH20805-PA 1..504 5..504 1152 45.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-PA 503 CG10243-PA 1..503 5..507 2647 100 Plus
Cyp6a19-PB 367 CG10243-PB 1..366 5..370 1894 98.9 Plus
Cyp6a20-PB 501 CG10245-PB 1..501 5..504 1858 66.3 Plus
Cyp6a17-PB 501 CG10241-PB 2..501 7..506 1370 50.7 Plus
Cyp6a17-PA 501 CG10241-PA 2..501 7..506 1370 50.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 18:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18702-PA 500 GI18702-PA 1..498 5..504 1440 51.4 Plus
Dmoj\GI18703-PA 472 GI18703-PA 1..472 5..506 1296 49.4 Plus
Dmoj\GI20230-PA 506 GI20230-PA 1..506 5..504 1186 45.2 Plus
Dmoj\GI20228-PA 506 GI20228-PA 1..506 5..504 1166 43.8 Plus
Dmoj\GI18701-PA 496 GI18701-PA 1..494 5..504 1162 45 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 18:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10375-PA 503 GL10375-PA 1..503 5..506 1880 65.8 Plus
Dper\GL10374-PA 500 GL10374-PA 1..500 5..506 1406 51.4 Plus
Dper\GL10373-PA 500 GL10373-PA 1..500 5..506 1395 50.8 Plus
Dper\GL10973-PA 506 GL10973-PA 1..506 5..504 1156 43.2 Plus
Dper\GL11709-PA 471 GL11709-PA 6..471 7..504 1136 45.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 18:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24955-PA 501 GA24955-PA 1..501 5..506 1862 65.6 Plus
Dpse\GA24953-PA 500 GA24953-PA 1..500 5..506 1407 51 Plus
Dpse\GA24954-PA 500 GA24954-PA 1..500 5..506 1402 51.2 Plus
Dpse\GA10190-PA 504 GA10190-PA 6..504 7..504 1211 47 Plus
Dpse\GA21788-PA 506 GA21788-PA 1..506 5..504 1156 43.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 18:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21579-PA 502 GM21579-PA 1..502 5..506 1429 51.5 Plus
Dsec\GM21578-PA 501 GM21578-PA 12..501 17..506 1388 51.1 Plus
Dsec\GM20167-PA 519 GM20167-PA 12..519 3..504 1232 47.1 Plus
Dsec\GM21577-PA 499 GM21577-PA 8..494 7..504 1183 46.2 Plus
Dsec\GM21581-PA 374 GM21581-PA 2..235 270..503 1164 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 18:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11086-PA 503 GD11086-PA 1..503 5..507 2585 94.6 Plus
Dsim\GD11087-PA 501 GD11087-PA 1..501 5..504 1892 65.7 Plus
Dsim\GD11084-PA 502 GD11084-PA 1..502 5..506 1433 51.7 Plus
Dsim\GD11083-PA 501 GD11083-PA 2..501 7..506 1402 50.5 Plus
Dsim\GD25645-PA 506 GD25645-PA 6..506 7..504 1229 47.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 18:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21721-PA 500 GJ21721-PA 1..500 5..506 1466 52.6 Plus
Dvir\GJ21720-PA 496 GJ21720-PA 1..494 5..504 1169 45 Plus
Dvir\GJ20178-PA 508 GJ20178-PA 1..506 5..504 1169 44 Plus
Dvir\GJ20179-PA 507 GJ20179-PA 2..504 5..501 1157 44.4 Plus
Dvir\GJ21722-PA 498 GJ21722-PA 5..489 1..495 1146 43.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 18:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21516-PA 505 GK21516-PA 17..504 21..506 1779 63.7 Plus
Dwil\GK21515-PA 505 GK21515-PA 1..504 5..506 1774 61.9 Plus
Dwil\GK21514-PA 505 GK21514-PA 17..504 21..506 1728 61.9 Plus
Dwil\GK15638-PA 499 GK15638-PA 1..499 5..505 1535 55 Plus
Dwil\GK21511-PA 501 GK21511-PA 21..501 25..504 1402 53.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 18:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13620-PA 503 GE13620-PA 1..503 5..507 2526 91.3 Plus
Dyak\GE13621-PA 504 GE13621-PA 1..501 5..504 1903 66.3 Plus
Dyak\GE13619-PA 502 GE13619-PA 1..500 5..504 1432 52.1 Plus
Dyak\GE13618-PA 501 GE13618-PA 20..501 25..506 1378 51.8 Plus
Dyak\GE12274-PA 506 GE12274-PA 6..506 7..504 1219 47.7 Plus

RE34964.hyp Sequence

Translation from 0 to 1523

> RE34964.hyp
SLLKMAILLGLVVGVLTLVAWWVLQNYTYWKRRGIPHDPPNIPLGNTGEL
WRTMPLAGILKRTYLKFRKQTDGPFAGFYLYAMKYIVITDVDFVKTVLIR
DFDKFHDRGVYHNEKDDPLTNNLATIEGQKWKNLRQKLTHTFTSAKMKSM
FSTVLNVGDEMIRVVDEKISSSSQTLEVTDIVSRFTSDVIGICAFGLKCN
SLRDPKAEFVQMGYSALRERRHGWLVDLLIFGMPKLAVKLGFQFLLPSVQ
KFYMKIVQDTIDYRMKRKVTRNDFMDTLIDMKQQYDKGDKENGLAFNEVA
AQAFVFFLAGFEAGSTTMGFTLYELACNQDVQDKLRAEIDSVLERYNGKL
EYDSMQDLFYMEKVINESLRKHPVVAHLARIATKPYQHSNPKYFIEAGTG
VLVSTLGIHHDPEFYPEPEKFIPERFDEEQVKKRPTCAFLPFGAGPRNCI
GLRFGRMQVIIGLALLIHNFRFELHPKTPVPMKYTINNLLLGSEGGIHLN
ITKVVRD*

RE34964.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp6a19-PA 503 CG10243-PA 1..503 5..507 2647 100 Plus
Cyp6a19-PB 367 CG10243-PB 1..366 5..370 1894 98.9 Plus
Cyp6a20-PB 501 CG10245-PB 1..501 5..504 1858 66.3 Plus
Cyp6a17-PB 501 CG10241-PB 2..501 7..506 1370 50.7 Plus
Cyp6a17-PA 501 CG10241-PA 2..501 7..506 1370 50.7 Plus