Clone RE35237 Report

Search the DGRC for RE35237

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:352
Well:37
Vector:pFlc-1
Associated Gene/Transcriptsna-RA
Protein status:RE35237.pep: gold
Preliminary Size:1670
Sequenced Size:1677

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3956 2002-01-01 Sim4 clustering to Release 2
CG3956 2003-01-01 Sim4 clustering to Release 3
CG3956 2003-08-11 Blastp of sequenced clone
sna 2008-04-29 Release 5.5 accounting
sna 2008-08-15 Release 5.9 accounting
sna 2008-12-18 5.12 accounting

Clone Sequence Records

RE35237.complete Sequence

1677 bp (1677 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010255

> RE35237.complete
GACAGCCACCTCAGCTCTCGTTGAGAACGCAACCACCGCTCTATACTCGA
TCCCGAACTATATAACTCGCCTCTCGATCGCCGATCTCCCGATTTACCCA
TCTCGATCAGTACCGGAAACTAAAACTTAATCACACACACATCAAAAATG
GCCGCCAACTACAAAAGCTGCCCGCTAAAGAAGCGCCCCATTGTCTTCGT
GGAGGAGCGTCTGCCACAAACGGAGGCCTTGGCCCTGACCAAGGACTCAC
AGTTTGCCCAGGATCAGCCGCAGGATCTATCCCTGAAACGGGGTCGCGAC
GAGGAGACCCAGGATTATCAGCAGCCGGAACCGAAACGTGACTATGTGCT
GAACCTTTCAAAAACACCGGAAAGGAACTCCAGCTCTAGCTCCAACTCCT
GCCTGCTGTCGCCGCCAGTGGAGGCCCAGGATTACCTGCCCACCGAAATC
CATATGCGTGGACTAACGGCAGGAACAACGGGATATACCACCGCCACCCC
CACCACGATTAATCCCTTCCAGTCCGCCTTTGTGATGGCCGCCGGTTGCA
ATCCGATCTCTGCCCTGTGGAGCAGCTATCAGCCCCATCTGGCCGCCTTC
CCCTCGCCAGCCAGCTCGATGGCCTCGCCCCAGTCGGTCTACAGCTACCA
GCAGATGACGCCGCCCTCCAGCCCCGGATCCGATCTGGAAACCGGTTCCG
AGCCAGAGGATCTTTCAGTGCGAAATGACATCCCACTGCCGGCTCTGTTC
CACCTTTTCGATGAGGCCAAGTCCAGCAGCAGCGGTGCCAGTGTAAGCAG
CTCATCGGGATACTCCTACACTCCGGCCATGAGTGCCTCGTCGGCGAGTG
TTGCCGCCAATCATGCCAAAAACTACCGCTTCAAGTGCGACGAGTGCCAG
AAGATGTACTCCACCTCGATGGGCCTGTCCAAGCACCGTCAGTTCCACTG
CCCGGCAGCCGAGTGTAATCAGGAGAAGAAGACCCACTCCTGCGAGGAGT
GTGGAAAGCTGTACACCACCATTGGAGCCCTGAAGATGCACATCCGCACC
CACACTCTGCCCTGCAAGTGCCCCATTTGCGGCAAGGCCTTCTCTCGACC
CTGGCTGCTCCAGGGACACATCCGCACCCACACTGGAGAGAAGCCTTTCC
AGTGCCCCGACTGCCCACGATCCTTTGCCGACCGCTCGAACCTGCGAGCT
CATCAGCAGACCCACGTGGACGTCAAGAAGTACGCCTGCCAGGTGTGCCA
CAAATCTTTCTCCAGGATGTCGCTCCTGAACAAGCACTCCAGCTCCAACT
GCACCATCACTATTGCGTAGGATTCTCGACATATGAATCCCTTAGCAGGA
CACAATTACCTAAGCAAACTCACATTCCGCTGGCGAAGACCAAACAAACA
GACAATACCTATTATAAGTTTGTACTAAGTCGATTCGGTTTTGGTGCTAC
TATTACTATATTTATTTCAGCTATAGTATTCTAAGTTTAAGTTCATGTAT
ATTGCCTCATTGTCACACGCAGCATTTTACCAAATCTATTCATTTAATTA
TAATATACCCTTATTTATGTATTCTCAGTACTGTTAAGCCAACTGTTGTT
AAGATTATTCCTAGCTTAAAGAGAAGAATTAAATATTTTTATAAAATAAA
ACTCACGAAAAGAAAAAAAAAAAAAAA

RE35237.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
sna-RA 1677 sna-RA 17..1677 2..1662 8305 100 Plus
esg-RA 2287 esg-RA 1302..1514 1027..1239 495 82.1 Plus
wor-RA 2301 wor-RA 1405..1527 1027..1149 390 87.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15475303..15476963 1662..2 8305 100 Minus
chr2L 23010047 chr2L 15333852..15334151 940..1239 555 79 Plus
chr2L 23010047 chr2L 15422794..15423036 1149..907 405 77.8 Minus
chr3L 24539361 chr3L 584620..584740 1155..1035 215 78.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
sna-RA 1173 CG3956-PA 1..1173 148..1320 5865 100 Plus
esg-RA 1413 CG3758-PA 985..1284 940..1239 555 79 Plus
wor-RA 1647 CG4158-PA 1060..1302 907..1149 405 77.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:51:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
sna-RA 1668 CG3956-RA 8..1668 2..1662 8305 100 Plus
esg-RA 2273 CG3758-RA 1213..1512 940..1239 555 79 Plus
wor-RA 2222 CG4158-RA 1210..1452 907..1149 405 77.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
sna-PA 390 CG3956-PA 1..390 148..1317 1683 100 Plus
wor-PA 548 CG4158-PA 344..485 877..1302 604 74.6 Plus
esg-PA 470 CG3758-PA 308..449 877..1302 601 72.5 Plus
Kah-PA 442 CG17181-PA 121..255 886..1302 417 54 Plus
CG12605-PC 474 CG12605-PC 294..430 880..1302 411 53.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15476590..15478253 1665..2 8320 100 Minus
2L 23513712 2L 15335078..15335377 940..1239 555 79 Plus
2L 23513712 2L 15424067..15424309 1149..907 405 77.8 Minus
3L 28110227 3L 584764..584884 1155..1035 215 78.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15476590..15478253 1665..2 8320 100 Minus
2L 23513712 2L 15335165..15335377 1027..1239 495 82.1 Plus
2L 23513712 2L 15424067..15424189 1149..1027 390 87.8 Minus
3L 28103327 3L 584764..584884 1155..1035 215 78.5 Minus
Blast to na_te.dros performed on 2014-11-26 20:39:21 has no hits.

RE35237.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:19:03 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15475340..15476963 1..1625 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:11:47 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 1..1173 148..1320 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:52:16 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 1..1173 148..1320 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:10:04 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 1..1173 148..1320 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:08 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 1..1173 148..1320 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:19:03 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 1..1173 148..1320 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:15:53 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 16..1677 1..1662 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:52:16 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 16..1677 1..1662 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:04 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 7..1668 1..1662 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:08 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 16..1677 1..1662 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:19:03 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
sna-RA 7..1668 1..1662 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:19:03 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15476593..15478253 1..1662 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:04 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15476593..15478253 1..1662 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:18 Download gff for RE35237.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15476593..15478253 1..1662 99   Minus

RE35237.pep Sequence

Translation from 147 to 1319

> RE35237.pep
MAANYKSCPLKKRPIVFVEERLPQTEALALTKDSQFAQDQPQDLSLKRGR
DEETQDYQQPEPKRDYVLNLSKTPERNSSSSSNSCLLSPPVEAQDYLPTE
IHMRGLTAGTTGYTTATPTTINPFQSAFVMAAGCNPISALWSSYQPHLAA
FPSPASSMASPQSVYSYQQMTPPSSPGSDLETGSEPEDLSVRNDIPLPAL
FHLFDEAKSSSSGASVSSSSGYSYTPAMSASSASVAANHAKNYRFKCDEC
QKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHIR
THTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLR
AHQQTHVDVKKYACQVCHKSFSRMSLLNKHSSSNCTITIA*

RE35237.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 21:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14523-PA 396 GF14523-PA 1..396 1..390 1457 76.3 Plus
Dana\GF14525-PA 548 GF14525-PA 339..480 244..385 597 75.4 Plus
Dana\GF15382-PA 483 GF15382-PA 242..456 153..380 585 55.7 Plus
Dana\GF25020-PA 670 GF25020-PA 455..607 229..385 413 49.7 Plus
Dana\GF24781-PA 614 GF24781-PA 418..563 238..385 410 53.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 21:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24206-PA 390 GG24206-PA 1..390 1..390 2080 99.2 Plus
Dere\GG25158-PA 465 GG25158-PA 226..440 153..381 607 55.5 Plus
Dere\GG24207-PA 548 GG24207-PA 344..485 244..385 593 74.6 Plus
Dere\GG14232-PA 621 GG14232-PA 403..577 209..385 423 49.2 Plus
Dere\GG15174-PA 652 GG15174-PA 450..602 229..385 405 49 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 21:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13116-PA 404 GH13116-PA 1..404 1..390 1519 77.5 Plus
Dgri\GH22585-PA 404 GH22585-PA 1..404 1..390 1519 77.5 Plus
Dgri\GH13119-PA 563 GH13119-PA 353..494 244..385 586 73.9 Plus
Dgri\GH13754-PA 546 GH13754-PA 374..511 244..381 569 73.2 Plus
Dgri\GH15707-PA 702 GH15707-PA 496..652 232..390 418 50.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 21:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
sna-PA 390 CG3956-PA 1..390 1..390 2084 100 Plus
esg-PA 470 CG3758-PA 231..449 153..385 653 55.4 Plus
wor-PA 548 CG4158-PA 302..485 207..385 605 61.4 Plus
CG12605-PC 474 CG12605-PC 256..430 209..385 433 48 Plus
CG12605-PE 619 CG12605-PE 401..575 209..385 433 48 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 21:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22640-PA 404 GI22640-PA 1..404 1..390 1488 76.8 Plus
Dmoj\GI22651-PA 588 GI22651-PA 378..519 244..385 588 74.6 Plus
Dmoj\GI17894-PA 537 GI17894-PA 367..504 244..381 570 73.2 Plus
Dmoj\GI12763-PA 735 GI12763-PA 534..690 227..385 414 50.9 Plus
Dmoj\GI12551-PA 672 GI12551-PA 466..617 230..385 412 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 21:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26593-PA 408 GL26593-PA 1..408 1..390 1500 76.1 Plus
Dper\GL26425-PA 499 GL26425-PA 260..475 153..385 593 54.7 Plus
Dper\GL26594-PA 558 GL26594-PA 360..501 244..385 588 73.9 Plus
Dper\GL22596-PA 400 GL22596-PA 110..227 247..385 298 45.3 Plus
Dper\GL16198-PA 409 GL16198-PA 279..356 308..385 288 62.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 21:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17803-PA 410 GA17803-PA 1..410 1..390 1501 75.7 Plus
Dpse\GA17666-PA 499 GA17666-PA 260..475 153..385 593 54.7 Plus
Dpse\GA17994-PA 561 GA17994-PA 356..497 244..385 588 73.9 Plus
Dpse\GA11715-PA 633 GA11715-PA 435..580 238..385 411 53.3 Plus
Dpse\GA14370-PA 413 GA14370-PA 110..244 247..385 393 54 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 21:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14336-PA 390 GM14336-PA 1..390 1..390 2086 99.7 Plus
Dsec\GM14357-PA 529 GM14357-PA 325..466 244..385 590 73.9 Plus
Dsec\GM16048-PA 348 GM16048-PA 200..323 258..381 481 70.2 Plus
Dsec\GM14024-PA 619 GM14024-PA 401..575 209..385 414 48 Plus
Dsec\GM11368-PA 247 GM11368-PA 60..197 244..385 401 52.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 21:08:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21953-PA 390 GD21953-PA 1..390 1..390 2081 99.5 Plus
Dsim\GD24004-PA 467 GD24004-PA 211..442 146..381 614 53.3 Plus
Dsim\GD21956-PA 548 GD21956-PA 344..485 244..385 592 74.6 Plus
Dsim\GD13305-PA 229 GD13305-PA 11..185 209..385 403 48 Plus
Dsim\GD13304-PA 283 GD13304-PA 65..239 209..385 400 47.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 21:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23192-PA 401 GJ23192-PA 1..401 1..390 1481 77.9 Plus
Dvir\GJ23203-PA 568 GJ23203-PA 366..507 244..385 592 74.6 Plus
Dvir\GJ17399-PA 522 GJ17399-PA 352..493 244..385 574 71.8 Plus
Dvir\GJ16104-PA 646 GJ16104-PA 452..597 238..385 409 53.3 Plus
Dvir\GJ16103-PA 660 GJ16103-PA 448..599 230..385 408 49.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 21:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18251-PA 408 GK18251-PA 1..408 1..390 1357 69 Plus
Dwil\GK18133-PA 494 GK18133-PA 260..482 153..385 595 55.1 Plus
Dwil\GK18253-PA 523 GK18253-PA 341..482 244..385 590 74.6 Plus
Dwil\GK17507-PA 716 GK17507-PA 501..652 230..385 415 50 Plus
Dwil\GK16692-PA 750 GK16692-PA 550..695 238..385 411 53.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 21:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19401-PA 390 GE19401-PA 1..390 1..390 2067 98.7 Plus
Dyak\GE20968-PA 467 GE20968-PA 228..442 153..381 603 55.5 Plus
Dyak\GE19402-PA 553 GE19402-PA 347..488 244..385 594 74.6 Plus
Dyak\GE20660-PA 475 GE20660-PA 257..431 209..385 420 49.2 Plus
Dyak\GE21392-PA 659 GE21392-PA 457..609 229..385 406 49.7 Plus

RE35237.hyp Sequence

Translation from 147 to 1319

> RE35237.hyp
MAANYKSCPLKKRPIVFVEERLPQTEALALTKDSQFAQDQPQDLSLKRGR
DEETQDYQQPEPKRDYVLNLSKTPERNSSSSSNSCLLSPPVEAQDYLPTE
IHMRGLTAGTTGYTTATPTTINPFQSAFVMAAGCNPISALWSSYQPHLAA
FPSPASSMASPQSVYSYQQMTPPSSPGSDLETGSEPEDLSVRNDIPLPAL
FHLFDEAKSSSSGASVSSSSGYSYTPAMSASSASVAANHAKNYRFKCDEC
QKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHIR
THTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLR
AHQQTHVDVKKYACQVCHKSFSRMSLLNKHSSSNCTITIA*

RE35237.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
sna-PA 390 CG3956-PA 1..390 1..390 2084 100 Plus
esg-PA 470 CG3758-PA 231..449 153..385 653 55.4 Plus
wor-PA 548 CG4158-PA 302..485 207..385 605 61.4 Plus
CG12605-PC 474 CG12605-PC 256..430 209..385 433 48 Plus
CG12605-PE 619 CG12605-PE 401..575 209..385 433 48 Plus