Clone RE36793 Report

Search the DGRC for RE36793

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:367
Well:93
Vector:pFlc-1
Associated Gene/TranscriptCG10433-RA
Protein status:RE36793.pep: gold
Sequenced Size:961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10433-RA 2010-01-13 Manual selection by Sue Celniker

Clone Sequence Records

RE36793.complete Sequence

961 bp assembled on 2010-02-11

GenBank Submission: BT120316.1

> RE36793.complete
AGTTCAACGCAAACCGCGCCATCGAGAGGAAGTGGATTACTGCTGCTGCC
AAGCTGCCAGAGTGAAGTGCATTGAAAGCAGAGCGAATCAGAACGAAATT
CAAAACGTATCACGCATACGCCCGGTAGTACAGCCGAATATCCCCAAATA
GCCGAATATGTCGCCGAGAAGGAGCTTGCTGTGCTGCCTGCTGGTGAGCA
GCATCCTAGTGCTGCACCAGGCTCAGGCCAACATCGAGACAAACGATGTG
AATGACCCCAGTTACTACATGCTGCAGGGTGTGCGTGTGTATCCCAATGA
CCGACAGTGCGTCATGGTCGGAGGACTGTGTGTCGCGGAGTCGGACTGCA
TCGAACCCACCTCGAACAAGGGATTGTGTCCCACGAGTGCCGGAGAGGGC
GTGGAGTGCTGCTACGAACTGCCGGTCAGACCAGCGCCCTGTGCGGAACA
CCTGGGACAGTGCATGGACCGATGCCACCAGAGGCTCCTGCGACCCGGTT
CGGATTGCAAGAATGGCCAAGTCTGCTGCGTCCTGATTTAGTTATACTTA
ACCACACCATACACATACCCGTGCAGAGGAACAGCATCGTCAAATGATAA
CAAAATAGCCTCCAAGTTGGGCAAGTCAGAGTGACAATTCTTGAATACCT
AAAGTTTATATTCGAGACTTCTAGAATATTCGAAAAATATTAGACAACAC
TAACATTAAATTGATTTGACAAAATTGAGTGCTGAGCGGATTGAAACTAA
TTTGGTTGTGTCATTCCTCTGTACACATACACACACACACACACCGTACA
TAAACATGTATTTATTTAACTATATGTATATTAATTATATTGTACGAATA
ATTTTGTATGACATCTTAAGAGCCCCAAATCTACCCACAATGTGAAATAT
TTGACTGCTTCCAATAAATGCATTGTAAATATTTTCCAAAAAAAAGAAAA
AAAAAAAAAAA

RE36793.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433.a 1284 CG10433.a 104..1048 1..945 4710 99.8 Plus
CG10433-RA 1331 CG10433-RA 335..1279 1..945 4710 99.8 Plus
CG10433-RB 1371 CG10433-RB 854..1371 420..937 2590 100 Plus
CG10433-RB 1371 CG10433-RB 268..687 1..420 2100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17492081..17492606 945..420 2615 99.8 Minus
chr2R 21145070 chr2R 17493094..17493362 269..1 1345 100 Minus
chr2R 21145070 chr2R 17492881..17493030 419..270 750 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-RC 384 CG10433-PC 1..384 158..541 1920 100 Plus
CG10433-RA 384 CG10433-PA 1..384 158..541 1920 100 Plus
CG10433-RB 297 CG10433-PB 1..263 158..420 1315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:37 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-RC 1945 CG10433-RC 1009..1945 1..937 4685 100 Plus
CG10433-RA 945 CG10433-RA 9..945 1..937 4685 100 Plus
CG10433-RB 1112 CG10433-RB 595..1112 420..937 2590 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-PC 127 CG10433-PC 1..127 158..538 622 100 Plus
CG10433-PA 127 CG10433-PA 1..127 158..538 622 100 Plus
CG10433-PB 98 CG10433-PB 1..96 158..445 405 93.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21605668..21606193 945..420 2615 99.8 Minus
2R 25286936 2R 21606681..21606949 269..1 1345 100 Minus
2R 25286936 2R 21606468..21606617 419..270 750 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21606867..21607392 945..420 2615 99.8 Minus
2R 25260384 2R 21607880..21608148 269..1 1345 100 Minus
2R 25260384 2R 21607667..21607816 419..270 750 100 Minus
Blast to na_te.dros performed 2014-11-26 20:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Kepler 722 Dbuz\Kepler KEPLER 722bp 425..490 831..763 131 68.1 Minus
transib3 2883 transib3 TRANSIB3 2883bp 2613..2661 806..853 116 73.5 Plus

RE36793.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:27:16 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17493094..17493362 1..269 100   Minus
chr2R 17492881..17493030 270..419 100 <- Minus
chr2R 17492080..17492606 420..946 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 10:16:01 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:24:28 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:02:54 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:16 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 1..384 158..541 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 10:16:00 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 5..941 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:24:27 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 5..941 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:02:54 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 9..945 1..937 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:16 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
CG10433-RA 9..945 1..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:27:16 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21606681..21606949 1..269 100   Minus
2R 21606468..21606617 270..419 100 <- Minus
2R 21605667..21606193 420..946 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:02:54 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17494186..17494454 1..269 100   Minus
arm_2R 17493973..17494122 270..419 100 <- Minus
arm_2R 17493172..17493698 420..946 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:11:38 Download gff for RE36793.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21607880..21608148 1..269 100   Minus
2R 21607667..21607816 270..419 100 <- Minus
2R 21606866..21607392 420..946 99 <- Minus

RE36793.pep Sequence

Translation from 157 to 540

> RE36793.pep
MSPRRSLLCCLLVSSILVLHQAQANIETNDVNDPSYYMLQGVRVYPNDRQ
CVMVGGLCVAESDCIEPTSNKGLCPTSAGEGVECCYELPVRPAPCAEHLG
QCMDRCHQRLLRPGSDCKNGQVCCVLI*

RE36793.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12088-PA 129 GF12088-PA 1..129 1..127 519 74.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20765-PA 98 GG20765-PA 1..98 1..98 436 84.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20050-PA 129 GH20050-PA 1..129 1..127 332 52.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-PC 127 CG10433-PC 1..127 1..127 702 100 Plus
CG10433-PA 127 CG10433-PA 1..127 1..127 702 100 Plus
CG10433-PB 98 CG10433-PB 1..96 1..96 485 93.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20459-PA 130 GI20459-PA 11..128 10..127 396 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:31:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17485-PA 129 GL17485-PA 1..129 1..127 509 75.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10315-PA 129 GA10315-PA 1..129 1..127 509 75.2 Plus
Dpse\GA10315-PB 127 GA10315-PB 1..99 1..93 314 63.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15708-PA 98 GM15708-PA 1..97 1..97 456 90.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25186-PA 98 GD25186-PA 1..97 1..97 459 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22309-PA 128 GJ22309-PA 10..128 11..127 418 71.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22257-PA 128 GK22257-PA 22..128 24..127 402 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13697-PA 98 GE13697-PA 1..97 1..97 432 83.5 Plus

RE36793.hyp Sequence

Translation from 157 to 540

> RE36793.hyp
MSPRRSLLCCLLVSSILVLHQAQANIETNDVNDPSYYMLQGVRVYPNDRQ
CVMVGGLCVAESDCIEPTSNKGLCPTSAGEGVECCYELPVRPAPCAEHLG
QCMDRCHQRLLRPGSDCKNGQVCCVLI*

RE36793.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10433-PC 127 CG10433-PC 1..127 1..127 702 100 Plus
CG10433-PA 127 CG10433-PA 1..127 1..127 702 100 Plus
CG10433-PB 98 CG10433-PB 1..96 1..96 485 93.8 Plus