Clone RE36967 Report

Search the DGRC for RE36967

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:369
Well:67
Vector:pFlc-1
Associated Gene/TranscriptDoc3-RA
Protein status:RE36967.pep: gold
Preliminary Size:1275
Sequenced Size:1683

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5093 2001-12-17 Blastp of sequenced clone
CG5093 2002-01-01 Sim4 clustering to Release 2
CG5093 2003-01-01 Sim4 clustering to Release 3
Doc3 2008-04-29 Release 5.5 accounting
Doc3 2008-08-15 Release 5.9 accounting
Doc3 2008-12-18 5.12 accounting

Clone Sequence Records

RE36967.complete Sequence

1683 bp (1683 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071335

> RE36967.complete
AGTGTCAATCTGGACAGCAAAGCGATCAGTTCGTGTTCCAGACGTCGATT
GCCCACGGAATAATATCAACGTATCACAAAAATAATAGATTACGCACATA
GCTCCACGAAGACCCCAAATATGTTGACCTTGCCCAACATCGCCGATCTG
CGATTGCAGCAGCAGATCGCCCAGGAGATATACCGCCAGCAGATTATGCA
ACGTTTACCCGATCCCCTATGCGGCCTGCTACCCAACTTTGCCGGACACT
TTATGCCACCGCCGCCACCGCCGCAACCCACTTTGCCCGGCGATGTGGAG
GCCAAGCTGGAGAATAACGAACTCTGGCAGCAGTTCCACAGCATCGGCAC
CGAGATGATCATCACCAAGTGCGGCAGACGCATGTTCCCTTCGATGCGGG
TTTCCCTCAGTGGACTGGAGGAGGAGGCCAGCTATTGCGTGCTCCTCGAG
ATGGTGCCCATTGGCGATTGTCGCTATAAGTTCTCTGGATCCCAGTGGGT
GCCGGCCGGAGGAGCCGAGCCCCAGAGCCCGCAGCGCATGTATCTGCATC
CGGAGAGTCCAGCCACGGGAAAACACTGGCAATCCCAGGCTCTGCTCTTC
AGCAAAGTGAAATTGACGAATAATACGCTGGATAACAATGGTCATATCGT
CTTGGCCAGCATGCACAAGTATCAGCCGCGTCTGCACGTCATACGAACCT
CTGATCTCGGCCAGATTCCCTGGGCCCCCCAACAGGCCTTTATCTTTCCG
GAGACGGAGTTTATAGCCGTAACAGCTTATCAGAATGACCGCATAACCAA
GCTGAAGATCGACAACAATCCCTTTGCCAAGGGATTCCGTGAGTCGGGTC
AGTCGAGATGCAAACGGAAGATCAATGACTCGCCACCGCCAACGCAGCCC
GAGGCAAACCAGGTGGATCGAAGCCCGGTGACATCGCCGTTAGCCAAACG
GTTGCGACTCGTGGAGGAATTTCCCCAGCACCATCATCACCAGAGTCATC
ACAGTGTTCCTATGCAGCGTCACTATCTGCTGGATGCTCTGGAGGCCAAT
TTCTATGTGCCAGCGCCACCGCCGCCGGCCATCGAGTATGCCAGGCACAT
CGGTGGTGCTTATCCAAGTTGGGCTTACACACCGCCATCGCCGGCCTCCT
CTGTCTCGTCCTCCTCGGCGGGCTCGACGAGCGGCGAATCTGCTGCCGAC
CGAGAGGCAGATGCCGATGCCGACACCTTTGTAGATGTGGTTGGAACCGC
ACCGGCTGCTCCTCCGCCTCCATCTCCGCCTGTGCCAGCCACTGCTACTG
CCCCTGCTTCGTCATCCAGCGATCCGACGATGGCCAAGCCGAAGCGCAGC
AGCTTCAGCATCTCGGACATATTAGGAACCAGCTCGTCCATTTAAAACTA
TCAAGTGCAGACGGGTGCATGTGCTCCCGTTTGGCTTGGAATCGGTGCCT
TGTACATTTAATTAGCGTTTAGTTGCCATCGTCTGCGTAGTGTCTAAGCT
GAATTGTGATATTTTGCAGTTAATTAGGATTTCCAGGTATTTGCCATCAG
TATTTATCGTATTTATTATGCAATTTTAATTGTTCACATGATTTCGTAAT
GGATTTATTGTCTTTGGCATTTTAATGCGGCATAAATAAAATTGTACGTA
CATATGTACGTATCCAATGAAAAAAAAAAAAAA

RE36967.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3.a 1912 Doc3.a 242..1912 1..1671 8340 99.9 Plus
Doc3-RA 1750 Doc3-RA 80..1750 1..1671 8340 99.9 Plus
Doc1-RA 1610 Doc1-RA 384..959 295..870 1500 84 Plus
Doc1-RA 1610 Doc1-RA 234..305 145..216 165 81.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8998344..8999221 781..1658 4330 99.5 Plus
chr3L 24539361 chr3L 8997756..8998026 375..645 1355 100 Plus
chr3L 24539361 chr3L 8997182..8997392 1..211 1040 99.5 Plus
chr3L 24539361 chr3L 9035311..9035568 375..632 870 89.1 Plus
chr3L 24539361 chr3L 8997454..8997620 211..377 805 98.8 Plus
chr3L 24539361 chr3L 8998142..8998279 646..783 675 99.3 Plus
chr3L 24539361 chr3L 9006689..9006908 637..418 470 80.9 Minus
chr3L 24539361 chr3L 9006465..9006599 783..649 390 85.9 Minus
chr3L 24539361 chr3L 9005503..9005594 872..781 250 84.8 Minus
chr3L 24539361 chr3L 9034042..9034122 295..375 240 86.4 Plus
chr3L 24539361 chr3L 9035650..9035787 646..783 225 77.5 Plus
chr3L 24539361 chr3L 9036269..9036358 781..870 210 82.2 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-RA 1275 CG5093-PA 1..1275 121..1395 6375 100 Plus
Doc1-RB 1071 CG5133-PB 70..645 295..870 1500 84 Plus
Doc1-RA 1176 CG5133-PA 175..750 295..870 1500 84 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-RA 1671 CG5093-RA 3..1671 1..1669 8330 99.9 Plus
Doc1-RB 1339 CG5133-RB 153..728 295..870 1500 84 Plus
Doc1-RA 1526 CG5133-RA 340..915 295..870 1500 84 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-PA 424 CG5093-PA 1..336 121..1128 1588 100 Plus
Doc1-PA 391 CG5133-PA 1..280 121..957 1033 76.4 Plus
Doc1-PB 356 CG5133-PB 24..245 295..957 990 84.7 Plus
Doc2-PA 469 CG5187-PA 1..252 121..885 964 76.6 Plus
bi-PE 970 CG3578-PE 327..515 292..858 595 53.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9006361..9007251 781..1671 4455 100 Plus
3L 28110227 3L 9005772..9006042 375..645 1355 100 Plus
3L 28110227 3L 9005198..9005408 1..211 1040 99.5 Plus
3L 28110227 3L 9043385..9043642 375..632 870 89.1 Plus
3L 28110227 3L 9005470..9005636 211..377 835 100 Plus
3L 28110227 3L 9006159..9006296 646..783 690 100 Plus
3L 28110227 3L 9014716..9014937 637..416 495 81.5 Minus
3L 28110227 3L 9014492..9014626 783..649 405 86.7 Minus
3L 28110227 3L 9013533..9013624 872..781 265 85.9 Minus
3L 28110227 3L 9042116..9042196 295..375 240 86.4 Plus
3L 28110227 3L 9043724..9043861 646..783 225 77.5 Plus
3L 28110227 3L 9044342..9044431 781..870 210 82.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8999461..9000351 781..1671 4455 100 Plus
3L 28103327 3L 8998872..8999142 375..645 1355 100 Plus
3L 28103327 3L 8998298..8998508 1..211 1040 99.5 Plus
3L 28103327 3L 9036485..9036742 375..632 870 89.1 Plus
3L 28103327 3L 8998570..8998736 211..377 835 100 Plus
3L 28103327 3L 8999259..8999396 646..783 690 100 Plus
3L 28103327 3L 9007887..9008037 566..416 455 86.7 Minus
3L 28103327 3L 9007592..9007726 783..649 405 86.6 Minus
3L 28103327 3L 9006633..9006724 872..781 265 85.8 Minus
3L 28103327 3L 9035216..9035296 295..375 240 86.4 Plus
3L 28103327 3L 9036824..9036961 646..783 225 77.5 Plus
3L 28103327 3L 9037442..9037531 781..870 210 82.2 Plus
3L 28103327 3L 9034664..9034719 145..200 160 85.7 Plus
3L 28103327 3L 9011912..9011967 200..145 145 83.9 Minus
Blast to na_te.dros performed on 2014-11-27 09:21:30 has no hits.

RE36967.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:42:12 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8998347..8999228 784..1669 99   Plus
chr3L 8998142..8998279 646..783 99 -> Plus
chr3L 8997759..8998026 378..645 100 -> Plus
chr3L 8997455..8997620 212..377 98 -> Plus
chr3L 8997182..8997392 1..211 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:12:57 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1275 121..1395 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:59:52 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1275 121..1395 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:06:43 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1275 121..1395 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:24:33 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1275 121..1395 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:42:12 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1275 121..1395 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:25:35 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1669 1..1669 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:59:52 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1669 1..1669 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:06:43 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 3..1671 1..1669 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:24:33 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1669 1..1669 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:42:12 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 3..1671 1..1669 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:42:12 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9006364..9007249 784..1669 100   Plus
3L 9006159..9006296 646..783 100 -> Plus
3L 9005775..9006042 378..645 100 -> Plus
3L 9005471..9005636 212..377 100 -> Plus
3L 9005198..9005408 1..211 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:06:43 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8999464..9000349 784..1669 100   Plus
arm_3L 8999259..8999396 646..783 100 -> Plus
arm_3L 8998875..8999142 378..645 100 -> Plus
arm_3L 8998571..8998736 212..377 100 -> Plus
arm_3L 8998298..8998508 1..211 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:59:51 Download gff for RE36967.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8999464..9000349 784..1669 100   Plus
3L 8999259..8999396 646..783 100 -> Plus
3L 8998875..8999142 378..645 100 -> Plus
3L 8998571..8998736 212..377 100 -> Plus
3L 8998298..8998508 1..211 99 -> Plus

RE36967.pep Sequence

Translation from 120 to 1394

> RE36967.pep
MLTLPNIADLRLQQQIAQEIYRQQIMQRLPDPLCGLLPNFAGHFMPPPPP
PQPTLPGDVEAKLENNELWQQFHSIGTEMIITKCGRRMFPSMRVSLSGLE
EEASYCVLLEMVPIGDCRYKFSGSQWVPAGGAEPQSPQRMYLHPESPATG
KHWQSQALLFSKVKLTNNTLDNNGHIVLASMHKYQPRLHVIRTSDLGQIP
WAPQQAFIFPETEFIAVTAYQNDRITKLKIDNNPFAKGFRESGQSRCKRK
INDSPPPTQPEANQVDRSPVTSPLAKRLRLVEEFPQHHHHQSHHSVPMQR
HYLLDALEANFYVPAPPPPAIEYARHIGGAYPSWAYTPPSPASSVSSSSA
GSTSGESAADREADADADTFVDVVGTAPAAPPPPSPPVPATATAPASSSS
DPTMAKPKRSSFSISDILGTSSSI*

RE36967.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24374-PA 404 GF24374-PA 1..404 1..424 1526 77.2 Plus
Dana\GF24375-PA 385 GF24375-PA 1..285 1..286 1139 75.7 Plus
Dana\GF10130-PA 461 GF10130-PA 1..252 1..255 1086 77.2 Plus
Dana\GF22584-PA 668 GF22584-PA 195..382 63..243 551 53.7 Plus
Dana\GF14392-PA 587 GF14392-PA 190..388 59..244 540 51.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14368-PA 428 GG14368-PA 1..428 1..424 1752 95.6 Plus
Dere\GG14369-PA 395 GG14369-PA 1..394 1..419 1171 59.7 Plus
Dere\GG15041-PA 467 GG15041-PA 1..252 1..255 1090 77.2 Plus
Dere\GG19051-PA 708 GG19051-PA 200..387 63..243 551 53.7 Plus
Dere\GG25073-PA 587 GG25073-PA 193..391 59..244 539 51.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16540-PA 442 GH16540-PA 1..442 1..424 1380 64.8 Plus
Dgri\GH14955-PA 478 GH14955-PA 1..252 1..255 1088 76.8 Plus
Dgri\GH16541-PA 389 GH16541-PA 10..250 9..251 1087 81.6 Plus
Dgri\GH12234-PA 722 GH12234-PA 190..391 48..243 550 51.7 Plus
Dgri\GH10290-PA 920 GH10290-PA 511..709 59..244 542 51.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-PA 424 CG5093-PA 1..424 1..424 2256 100 Plus
Doc1-PA 391 CG5133-PA 1..389 1..418 1161 59.4 Plus
Doc2-PA 469 CG5187-PA 1..252 1..255 1065 77.2 Plus
Doc1-PB 356 CG5133-PB 16..354 50..418 1046 60.6 Plus
bi-PE 970 CG3578-PE 319..685 50..400 609 37.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13829-PA 432 GI13829-PA 1..431 1..423 1484 69.9 Plus
Dmoj\GI13831-PA 393 GI13831-PA 1..250 1..251 1128 82.1 Plus
Dmoj\GI11482-PA 483 GI11482-PA 1..252 1..255 1086 76.4 Plus
Dmoj\GI15769-PA 719 GI15769-PA 197..398 48..243 548 51.2 Plus
Dmoj\GI17986-PA 592 GI17986-PA 192..390 59..244 531 51.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15033-PA 422 GL15033-PA 1..422 1..424 1547 76.2 Plus
Dper\GL15034-PA 392 GL15034-PA 1..279 1..280 1146 76.6 Plus
Dper\GL15081-PA 486 GL15081-PA 1..252 1..255 1084 77 Plus
Dper\GL14298-PA 1478 GL14298-PA 537..748 45..250 614 50.5 Plus
Dper\GL20248-PA 712 GL20248-PA 212..399 63..243 553 53.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18655-PA 424 GA18655-PA 1..424 1..424 1556 76.2 Plus
Dpse\GA18682-PA 392 GA18682-PA 1..279 1..280 1146 76.6 Plus
Dpse\GA18721-PA 486 GA18721-PA 1..252 1..255 1084 77 Plus
Dpse\GA22741-PA 983 GA22741-PA 350..545 58..250 618 52 Plus
Dpse\GA10837-PA 739 GA10837-PA 240..427 63..243 553 53.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25112-PA 424 GM25112-PA 1..424 1..424 1834 96.9 Plus
Dsec\GM25113-PA 391 GM25113-PA 1..390 1..419 1157 59.3 Plus
Dsec\GM24895-PA 467 GM24895-PA 1..252 1..255 1095 77.2 Plus
Dsec\GM12345-PA 559 GM12345-PA 322..516 58..249 613 51.8 Plus
Dsec\GM21356-PA 695 GM21356-PA 196..383 63..243 550 53.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14148-PA 424 GD14148-PA 1..424 1..424 2220 98.1 Plus
Dsim\GD14149-PA 391 GD14149-PA 1..390 1..419 1152 59.5 Plus
Dsim\GD12943-PA 582 GD12943-PA 198..367 86..255 861 87.6 Plus
Dsim\GD23341-PA 581 GD23341-PA 187..385 59..244 539 51.3 Plus
Dsim\GD23340-PA 665 GD23340-PA 281..479 59..244 532 51.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11695-PA 420 GJ11695-PA 1..420 1..424 1514 71.4 Plus
Dvir\GJ11697-PA 386 GJ11697-PA 1..280 1..279 1142 76.4 Plus
Dvir\bi-PA 975 GJ16959-PA 344..539 58..250 618 52 Plus
Dvir\GJ18625-PA 706 GJ18625-PA 206..393 63..243 544 53.2 Plus
Dvir\GJ19568-PA 605 GJ19568-PA 205..403 59..244 538 51.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12352-PA 425 GK12352-PA 1..424 1..423 1319 65.7 Plus
Dwil\GK12353-PA 408 GK12353-PA 1..251 1..251 1119 81.1 Plus
Dwil\GK12279-PA 540 GK12279-PA 1..252 1..255 1087 77 Plus
Dwil\GK15734-PA 953 GK15734-PA 334..529 58..250 616 52 Plus
Dwil\GK19893-PA 757 GK19893-PA 230..417 63..243 553 53.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20799-PA 422 GE20799-PA 1..422 1..424 1740 89.6 Plus
Dyak\GE20800-PA 388 GE20800-PA 1..285 1..286 1152 76.4 Plus
Dyak\GE21264-PA 466 GE21264-PA 1..252 1..255 1089 76.8 Plus
Dyak\GE16345-PA 961 GE16345-PA 322..517 58..250 617 52 Plus
Dyak\GE17455-PA 716 GE17455-PA 183..382 50..243 553 51.7 Plus

RE36967.hyp Sequence

Translation from 120 to 1394

> RE36967.hyp
MLTLPNIADLRLQQQIAQEIYRQQIMQRLPDPLCGLLPNFAGHFMPPPPP
PQPTLPGDVEAKLENNELWQQFHSIGTEMIITKCGRRMFPSMRVSLSGLE
EEASYCVLLEMVPIGDCRYKFSGSQWVPAGGAEPQSPQRMYLHPESPATG
KHWQSQALLFSKVKLTNNTLDNNGHIVLASMHKYQPRLHVIRTSDLGQIP
WAPQQAFIFPETEFIAVTAYQNDRITKLKIDNNPFAKGFRESGQSRCKRK
INDSPPPTQPEANQVDRSPVTSPLAKRLRLVEEFPQHHHHQSHHSVPMQR
HYLLDALEANFYVPAPPPPAIEYARHIGGAYPSWAYTPPSPASSVSSSSA
GSTSGESAADREADADADTFVDVVGTAPAAPPPPSPPVPATATAPASSSS
DPTMAKPKRSSFSISDILGTSSSI*

RE36967.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-PA 424 CG5093-PA 1..424 1..424 2256 100 Plus
Doc1-PA 391 CG5133-PA 1..389 1..418 1161 59.4 Plus
Doc2-PA 469 CG5187-PA 1..252 1..255 1065 77.2 Plus
Doc1-PB 356 CG5133-PB 16..354 50..418 1046 60.6 Plus
bi-PE 970 CG3578-PE 319..685 50..400 609 37.6 Plus