Clone RE37018 Report

Search the DGRC for RE37018

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:370
Well:18
Vector:pFlc-1
Associated Gene/Transcriptnuf-RD
Protein status:RE37018.pep: gold
Sequenced Size:2479

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
nuf-RD 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE37018.complete Sequence

2479 bp assembled on 2009-11-10

GenBank Submission: BT100278.1

> RE37018.complete
AGTCCTTGCCGCGCAGCCTTTGACGTCGATTGTGTGTCCGTGTATCCATC
CATCGCTTTTCAGTGCTCTCATCTCGATTGAATATAAAGTGCCACACTCT
CTAGAGTTGTCGTTGTCGCTTCGAGAAAATATAAACGAACAGTCTGCTTC
GGCCGTCAAATGAGCAAAGACTACGCGGCGATGCAGAAATAATTTGAATT
TTCTTAAGCCTGCGAGAAAACAGCATTCCTGAATAATGTGAAAAGATATA
TCAGCAAATATATAATCATTTGCACACCATATATATATATATATAGGCAA
ATGTATGTGAAATATCCCATGGCTGAGGTGCAGTTGGTGAACGATCTTCT
CCTCGATCTGCGGCACATGAAAAAAGATTGTCTGGAACTGCTGCAGCGCA
AGGTGGACGATCTGTCAGATACACAGAATATAGCTGAGGATCGGACAACC
CGCACCAAGACCGAATATGCAGTCCTTCAGGCGCGTTATCACATGCTCGA
AGAGCAGTACCGAGAGTCGGAACTGCGTGCCGAGGAGCGTTTGGCAGAGG
AGCAGAAGCGGCACCGCGAGATTTTGGCCCGCGTGGAGCGTGAAGCCTCG
CTGCAGAACGAGAACTGCCAGATGAAGATCCGTGCCACCGAGATCGAGGC
AACGGCACTGCGGGAAGAAGCCGCCCGACTGCGTGTCCTGTGTGACAAGC
AGGCCAATGACCTCCATCGCACCGAGGAACAGTTGGAGCTGGCGCGCGAC
CAAATCGGCGTCCTGCAACAGGAGCACGAGGAGCAGGCACAGGCACTGCG
CCGCCACGAACAGGAGAAGAAGTCCACCGAGGAGCTGATGCTGGAGCTGG
GCCGGGAACTGCAGCGTGCTCGCGAGGAGAGTGGAGCCCGGGCAATGCCG
ACCACATCGCCGGAGAGCATAAGACTGGAGGAGCTGCATCAGGAGCTCGA
GGAGATGCGCCAGAAGAACCGAACCCTCGAAGAACAGAACGAGGAGCTGC
AGGCCACGATGCTGACCAACCAGGCCACCATGCTGACAAATGGCGTGGAG
CAGGGTCGCCATCTGCTGAACGGAACACTCAACAGTTTGGCTCAGGAGCT
CGAGGAGATGTCACAAGCCCAGCTACAACAGGCCTTCCAGGAAAAGGAGG
ATGAAAATGTTCGGCTTAAGCACTATATTGATACCATTCTACTCAACATC
GTGGAGAACTATCCTCAATTGCTGGAAGTCAAGCCCATGGAGCGAAAGTA
GTGCAGTCTACTGGAAGAATAAACCAACCCTAGGCACTCGGCAGAGTGTC
ACAACCACCTAACATTACCTAAAATTAATAAACTAACTAAACCATACTCT
ATGTTAACTTTTTAAGCTACACTCTATACATGTATTTATGCCTAACTTAA
GTCATAATTTATTTTATAACAATTTAATGTAGATTTTTAAACCAAAACAA
CGCAGAGAACACAAAGATTGCATGTCAAAATGATAAAAAAGTCCTTAATT
TGATTAGATTATGTTTTGTATAAAGAGAGTCCAAAGTTATGTAAAAGTTT
ATTTTCCTTCGTTTCTAGTTTGCGTTTTGTATAGTTCGTGTTGTTGATCC
ATAAAGATATTACTTATAAATATTGTTAGATTTTAAGTCGTAAAAAATCT
TTCACTTATTAATGAAATGGAACCCAATAATTTATTGATAATTGCCAGAA
AATCTAATTGTGAATGTGTATAGCATAAAGAGATTTTATGAACTGTTGAT
GCTTGACAGGAAATATTTCCAATTTCGTCATGGCAGCTAAGAAGGTTTTT
GCTAGGACAAGTGCTCCATTTTTCAAATCTTTCCATCACATGCATACTTC
TTAAATCTTTCTATCCATATTTTGCACTCTCCGAAAAGATCTTCCCTAGT
TTGCCTGTAATGTAGTTACAAAAATCTATCAAAAAATTTGCGTTTATGGT
ATGGACAATCCCAGGATACAAAGACGGAGTTTTAGTTTGATGTGAGTCTA
AATGAGAGCAATTATCACGAGGAGTTTATCAATTCAGAAGTTATATCTTA
ATCCACACACATATGTCAATGTATAGCACAGATAAAACTAATCTTACTCT
GCATATAAAACAACATTAAATGGACATAATGTGCAAACGTTTAGGGATGA
CACATGATAGCTCCAACGAAAGCGATCCCTAATAGTCTTAGCAACTGAAT
AACTCAAGCGGTCAACCCTAATTTAGCTATAATAATATCCAAGAAAACTC
GATAATCGATGTGTAATCGTTAATCAAAATTTTATTGCCTTAAACGGATG
TTTTAAAAAATGTACTAAGGCTTAGATAACTCTAACAAAAAAGTCCATAA
GGTTTAATGACATGCTGCGAAATATGGAATTTTAAATGTAATTTACTAGA
TGCAAGTCGCTGAACTTATATCAAAATAAAAAGAAGAATATTTTATAAAA
AAAAAAAAAAAAAGAAAAAAAAAAAAAAA

RE37018.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-RD 2506 nuf-RD 1..2449 1..2449 12215 99.9 Plus
nuf.e 2557 nuf.e 1160..2489 1120..2449 6635 99.9 Plus
nuf.c 2530 nuf.c 1196..2525 1120..2449 6635 99.9 Plus
nuf.e 2557 nuf.e 2..1123 1..1122 5595 99.9 Plus
nuf.c 2530 nuf.c 419..1159 382..1122 3705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14222026..14223353 1120..2449 6510 99.5 Plus
chr3L 24539361 chr3L 14220757..14221215 515..973 2280 99.8 Plus
chr3L 24539361 chr3L 14219927..14220205 103..381 1395 100 Plus
chr3L 24539361 chr3L 14221280..14221428 974..1122 685 97.3 Plus
chr3L 24539361 chr3L 14220275..14220409 382..516 675 100 Plus
chr3L 24539361 chr3L 14218951..14219052 1..102 495 99 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-RD 951 CG33991-PD 1..951 301..1251 4755 100 Plus
nuf-RF 1587 CG33991-PF 718..1587 382..1251 4350 100 Plus
nuf-RE 1587 CG33991-PE 718..1587 382..1251 4350 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:52:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-RD 2448 CG33991-RD 3..2448 1..2446 12200 99.9 Plus
nuf-RF 3099 CG33991-RF 1035..3099 382..2446 10310 100 Plus
nuf-RE 3233 CG33991-RE 1169..3233 382..2446 10310 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-PD 316 CG33991-PD 1..316 301..1248 1336 100 Plus
nuf-PB 305 CG33991-PB 1..305 334..1248 1205 96.1 Plus
nuf-PA 502 CG33991-PA 198..502 334..1248 1205 96.1 Plus
nuf-PC 502 CG33991-PC 198..502 334..1248 1205 96.1 Plus
nuf-PM 318 CG33991-PM 1..318 334..1248 1181 92.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14231924..14233253 1120..2449 6635 99.9 Plus
3L 28110227 3L 14230654..14231112 515..973 2295 100 Plus
3L 28110227 3L 14229828..14230106 103..381 1395 100 Plus
3L 28110227 3L 14231177..14231325 974..1122 745 100 Plus
3L 28110227 3L 14230176..14230310 382..516 675 100 Plus
3L 28110227 3L 14228852..14228953 1..102 495 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14225024..14226353 1120..2449 6635 99.9 Plus
3L 28103327 3L 14223754..14224212 515..973 2295 100 Plus
3L 28103327 3L 14222928..14223206 103..381 1395 100 Plus
3L 28103327 3L 14224277..14224425 974..1122 745 100 Plus
3L 28103327 3L 14223276..14223410 382..516 675 100 Plus
3L 28103327 3L 14221952..14222053 1..102 495 99 Plus
Blast to na_te.dros performed 2014-11-26 20:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1456..1703 1473..1711 217 59.4 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 34..209 1711..1532 160 59 Minus
McClintock 6450 McClintock McCLINTOCK 6450bp 2703..2760 1300..1357 119 67.2 Plus

RE37018.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:21:44 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14222029..14223350 1123..2446 99   Plus
chr3L 14221280..14221428 974..1122 97 -> Plus
chr3L 14220759..14221215 517..973 99 -> Plus
chr3L 14220275..14220409 382..516 100 -> Plus
chr3L 14219927..14220205 103..381 100 -> Plus
chr3L 14218951..14219052 1..102 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-10 12:15:39 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 1..951 301..1251 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:21:15 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 1..951 301..1251 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:57:15 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 1..951 301..1251 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:21:44 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 1..951 301..1251 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-10 12:15:39 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 1..2446 1..2446 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:21:14 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 1..2446 1..2446 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:57:15 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 3..2448 1..2446 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:21:44 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
nuf-RD 3..2448 1..2446 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:21:44 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14231927..14233250 1123..2446 99   Plus
3L 14231177..14231325 974..1122 100 -> Plus
3L 14230656..14231112 517..973 100 -> Plus
3L 14230176..14230310 382..516 100 -> Plus
3L 14229828..14230106 103..381 100 -> Plus
3L 14228852..14228953 1..102 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:57:15 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14225027..14226350 1123..2446 99   Plus
arm_3L 14224277..14224425 974..1122 100 -> Plus
arm_3L 14223756..14224212 517..973 100 -> Plus
arm_3L 14223276..14223410 382..516 100 -> Plus
arm_3L 14222928..14223206 103..381 100 -> Plus
arm_3L 14221952..14222053 1..102 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:09:27 Download gff for RE37018.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14225027..14226350 1123..2446 99   Plus
3L 14224277..14224425 974..1122 100 -> Plus
3L 14223756..14224212 517..973 100 -> Plus
3L 14223276..14223410 382..516 100 -> Plus
3L 14222928..14223206 103..381 100 -> Plus
3L 14221952..14222053 1..102 99 -> Plus

RE37018.pep Sequence

Translation from 300 to 1250

> RE37018.pep
MYVKYPMAEVQLVNDLLLDLRHMKKDCLELLQRKVDDLSDTQNIAEDRTT
RTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREAS
LQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARD
QIGVLQQEHEEQAQALRRHEQEKKSTEELMLELGRELQRAREESGARAMP
TTSPESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVE
QGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNI
VENYPQLLEVKPMERK*

RE37018.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24596-PA 525 GF24596-PA 210..525 1..316 1493 96.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15679-PA 526 GG15679-PA 238..526 28..316 1465 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17096-PA 544 GH17096-PA 229..544 1..316 1360 91.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-PD 316 CG33991-PD 1..316 1..316 1576 100 Plus
nuf-PB 305 CG33991-PB 1..305 12..316 1445 96.1 Plus
nuf-PA 502 CG33991-PA 198..502 12..316 1445 96.1 Plus
nuf-PC 502 CG33991-PC 198..502 12..316 1445 96.1 Plus
nuf-PM 318 CG33991-PM 1..318 12..316 1421 92.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11698-PA 533 GI11698-PA 218..533 1..316 1337 90.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21004-PA 756 GL21004-PA 452..756 12..316 1262 88.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23801-PA 639 GA23801-PA 324..639 1..316 1381 91.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25461-PA 526 GM25461-PA 238..526 28..316 1446 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14486-PA 98 GD14486-PA 1..98 219..316 486 98 Plus
Dsim\GD14485-PA 66 GD14485-PA 1..66 12..83 238 73.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11373-PA 531 GJ11373-PA 216..531 1..316 1435 93 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12678-PA 781 GK12678-PA 466..781 1..316 1432 92.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22009-PA 527 GE22009-PA 239..527 28..316 1464 100 Plus

RE37018.hyp Sequence

Translation from 300 to 1250

> RE37018.hyp
MYVKYPMAEVQLVNDLLLDLRHMKKDCLELLQRKVDDLSDTQNIAEDRTT
RTKTEYAVLQARYHMLEEQYRESELRAEERLAEEQKRHREILARVEREAS
LQNENCQMKIRATEIEATALREEAARLRVLCDKQANDLHRTEEQLELARD
QIGVLQQEHEEQAQALRRHEQEKKSTEELMLELGRELQRAREESGARAMP
TTSPESIRLEELHQELEEMRQKNRTLEEQNEELQATMLTNQATMLTNGVE
QGRHLLNGTLNSLAQELEEMSQAQLQQAFQEKEDENVRLKHYIDTILLNI
VENYPQLLEVKPMERK*

RE37018.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
nuf-PD 316 CG33991-PD 1..316 1..316 1576 100 Plus
nuf-PB 305 CG33991-PB 1..305 12..316 1445 96.1 Plus
nuf-PA 502 CG33991-PA 198..502 12..316 1445 96.1 Plus
nuf-PC 502 CG33991-PC 198..502 12..316 1445 96.1 Plus
nuf-PM 318 CG33991-PM 1..318 12..316 1421 92.1 Plus