Clone RE40955 Report

Search the DGRC for RE40955

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:409
Well:55
Vector:pFlc-1
Associated Gene/Transcripth-RA
Protein status:RE40955.pep: gold
Sequenced Size:2151

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6511 2002-01-01 Sim4 clustering to Release 2
CG6494 2002-06-06 Blastp of sequenced clone
CG6494 2003-01-01 Sim4 clustering to Release 3
h 2008-04-29 Release 5.5 accounting
h 2008-08-15 Release 5.9 accounting
h 2008-12-18 5.12 accounting

Clone Sequence Records

RE40955.complete Sequence

2151 bp (2151 high quality bases) assembled on 2002-06-06

GenBank Submission: AY119633

> RE40955.complete
ATTCTCCTGCCGTATTTCGTAGCGTGCGGTTCTATCGCTCCGCTTTGATA
AACCGAATCGAAATCTAGAGAACCCCCCCAGACACAATACCATTTTACGT
GCTTCTCTGCGACGCTGCGCGAAAGTGAAACCACCAAGTGAACTTGAAAA
AAAAAAAAACTGACAACTTGAGTTATTCTAAAAAAGCAAAAAAGCAGTGA
ACTTATATTGCAAAGAGCAGCAAATTCAGATTTGCTGCCAAGTGAAAACC
AAACTGTGCCTCAAACTCAACAAACAATATCTGACCGAAATGGTTACCGG
CGTAACAGCAGCCAACATGACCAACGTTCTGGGCACCGCCGTTGTGCCGG
CCCAGCTCAAGGAGACGCCGCTCAAAAGTGACCGTCGGTCGAACAAGCCC
ATCATGGAGAAACGCCGACGTGCCCGTATTAACAACTGTCTCAATGAACT
CAAGACTCTGATTCTGGATGCCACCAAAAAAGACCCGGCTCGCCACTCCA
AATTGGAAAAGGCCGACATTCTGGAGAAGACAGTAAAGCATCTGCAGGAG
CTGCAGCGCCAGCAGGCAGCCATGCAGCAGGCCGCCGATCCCAAGATTGT
GAACAAATTCAAGGCCGGATTCGCCGACTGTGTGAACGAGGTTAGCCGCT
TTCCCGGCATCGAGCCCGCCCAGCGTCGTCGCCTGCTACAGCACCTGAGC
AACTGCATCAATGGCGTTAAGACAGAGCTGCACCAGCAGCAGCGCCAGCA
GCAACAGCAGTCCATCCACGCCCAGATGCTGCCCTCGCCGCCCAGCTCGC
CGGAGCAGGATAGCCAGCAGGGAGCAGCGGCACCCTACCTCTTTGGTATC
CAGCAGACGGCCAGCGGTTACTTTCTGCCCAATGGCATGCAGGTGATCCC
CACCAAGCTGCCCAACGGTAGCATTGCCCTCGTGTTGCCCCAGAGCCTGC
CCCAGCAGCAGCAGCAACAGTTGCTGCAGCACCAACAGCAGCAGCAGCAA
CTCGCCGTCGCAGCAGCAGCAGCGGCCGCAGCAGCAGCACAACAGCAACC
CATGTTGGTCAGCATGCCCCAGCGTACAGCCAGCACCGGATCCGCCAGCT
CGCACTCCTCCGCCGGATACGAGTCGGCGCCCGGAAGCAGCAGCAGCTGT
AGCTACGCCCCGCCCAGTCCGGCCAACTCTAGCTACGAGCCCATGGACAT
CAAGCCATCGGTCATCCAGCGCGTGCCAATGGAGCAGCAGCCCCTGTCGC
TGGTGATCAAGAAGCAGATCAAGGAGGAGGAGCAGCCCTGGCGGCCCTGG
TAGAGGGTGTCTGCATATGCATATCATATAGCATAGCCACCCCTATCGAA
TCTCCCGCTTTTAAGACTGACCCCCCACAACTCATCCAACTCGCACACAT
GCGCAGGCGTTGTGCGCATGCGCGTAGACATTTCACATCATTCGCCGGGA
TTGCGCAAATGTTGCTTTGAAGTGTTGCAAACATGCGAATCCTAAACTCG
GTTCACAACTTCGTTGGCTTAGTTTCCTGGCTTATATCCTGGAAACCCGT
CGACGAGGCTAAGGACCTTCATCAGACGCACCCACACACAAACACACACA
CGCAAACGTTGTTATAATTTATTTATTATTATATTATGTAATCGATTTGA
GAGAACGGTATTCTACCAGGACATCGCCAAACTACCTCAGTCCAAGTACT
TGGTGTTGAATTGCCTCATGTATCATGTATTACTCTTTGAATAACAGCAA
ATCAGCAAAAGTCTTCCAAACACAGAAAATGAAAATGCGAAAATAAGCAC
CTGAAAAGCTGAAATACTTTTTATGAAAAAGATAAACGCAAAAGCATAAC
TCTTACACATAGTCGTACATCTCCATTTAAGTATAGGTTTTGTACCATAG
CCAGCTAAGCCGCTTAGGGTTTCTCTCGCTCTTAAGTCTAATCAAAGAAT
AATTATATTTATAAAACACACAAATCTATTCGTAAGGCCACGTGATATAG
TGAACATAATGAGCTTCTAAGAAAACAAAACAAGAATTTGATGCAAGCAA
AAGCAAAAAAATCAACAAGAAAGAAAAAACAAACAAACAACACACTAAAA
AGAAATAAATTTAAAAGATTCTACTAAAAAATCAATAAAAAAAAAAAAAA
A

RE40955.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
hairy-RA 2380 hairy-RA 239..2374 1..2135 10625 99.9 Plus
hairy-RB 2380 hairy-RB 239..2374 1..2135 10625 99.9 Plus
dpn-RA 2185 dpn-RA 561..734 392..565 360 80.4 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8669622..8671273 485..2135 8060 99.3 Plus
chr3L 24539361 chr3L 8667979..8668364 1..388 1800 98.2 Plus
chr3L 24539361 chr3L 8669389..8669485 388..484 485 100 Plus
chr2R 21145070 chr2R 4117959..4118039 565..485 210 84 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
h-RB 1014 CG6494-PB 1..1014 290..1303 5070 100 Plus
h-RA 1014 CG6494-PA 1..1014 290..1303 5070 100 Plus
dpn-RA 1308 CG8704-PA 130..303 392..565 360 80.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:55:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
h-RB 2335 CG6494-RB 202..2335 1..2133 10605 99.9 Plus
h-RA 2139 CG6494-RA 6..2139 1..2133 10605 99.9 Plus
dpn-RA 2036 CG8704-RA 412..585 392..565 360 80.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
h-PB 337 CG6494-PB 1..337 290..1300 1024 100 Plus
h-PA 337 CG6494-PA 1..337 290..1300 1024 100 Plus
dpn-PA 435 CG8704-PA 41..157 383..721 336 62.4 Plus
Side-PA 507 CG10446-PA 19..178 299..730 244 39.3 Plus
E(spl)mgamma-HLH-PA 205 CG8333-PA 16..134 383..721 181 37.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8677605..8679255 485..2135 8255 100 Plus
3L 28110227 3L 8675960..8676348 1..388 1880 99.5 Plus
3L 28110227 3L 8677371..8677467 388..484 485 100 Plus
2R 25286936 2R 8230422..8230502 565..485 210 84 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8670705..8672355 485..2135 8255 100 Plus
3L 28103327 3L 8669060..8669448 1..388 1890 99.4 Plus
3L 28103327 3L 8670471..8670567 388..484 485 100 Plus
2R 25260384 2R 8231621..8231701 565..485 210 83.9 Minus
2R 25260384 2R 8232798..8232890 484..392 150 77.4 Minus
Blast to na_te.dros performed 2014-11-27 14:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2825..2930 937..1048 186 66.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..7079 670..1038 168 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6868 671..763 167 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2665 683..1021 162 55.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6825 671..759 154 67.4 Plus
roo 9092 roo DM_ROO 9092bp 1051..1152 662..759 147 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1583 687..760 140 70.3 Plus
roo 9092 roo DM_ROO 9092bp 1053..1129 681..760 140 67.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2386 689..759 138 71.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2372 698..760 132 71.9 Plus
roo 9092 roo DM_ROO 9092bp 1060..1141 682..760 131 67.1 Plus
roo 9092 roo DM_ROO 9092bp 1068..1109 720..761 129 78.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2382..2473 671..759 128 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6733..6771 722..759 120 82.1 Plus
roo 9092 roo DM_ROO 9092bp 1081..1120 722..760 116 80 Plus

RE40955.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:45:51 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8670187..8671273 1050..2136 96   Plus
chr3L 8669622..8670079 485..942 91 == Plus
chr3L 8669390..8669485 389..484 100 -> Plus
chr3L 8667979..8668364 1..388 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:15:46 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 1..1014 290..1303 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:22 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 1..1014 290..1303 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:18:27 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RA 1..1014 290..1303 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:28 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 1..1014 290..1303 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:45:51 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RA 1..1014 290..1303 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:01:25 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 202..2321 1..2119 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:22 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 202..2321 1..2119 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:18:27 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RA 6..2139 1..2133 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:28 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 202..2321 1..2119 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:45:51 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
h-RA 6..2139 1..2133 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:45:51 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8677605..8679255 485..2136 99   Plus
3L 8677372..8677467 389..484 100 -> Plus
3L 8675960..8676348 1..388 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:18:27 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8670705..8672355 485..2136 99   Plus
arm_3L 8670472..8670567 389..484 100 -> Plus
arm_3L 8669060..8669448 1..388 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:18 Download gff for RE40955.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8670705..8672355 485..2136 99   Plus
3L 8670472..8670567 389..484 100 -> Plus
3L 8669060..8669448 1..388 99 -> Plus

RE40955.pep Sequence

Translation from 289 to 1302

> RE40955.pep
MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNC
LNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAAD
PKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQ
QRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGM
QVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAA
QQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYE
PMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW*

RE40955.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24345-PA 346 GF24345-PA 1..346 1..337 1247 88.7 Plus
Dana\GF12602-PA 441 GF12602-PA 41..231 32..219 435 47 Plus
Dana\GF14690-PA 510 GF14690-PA 19..178 4..147 268 40.5 Plus
Dana\GF16796-PA 205 GF16796-PA 16..133 32..143 217 38.1 Plus
Dana\GF18225-PA 200 GF18225-PA 14..136 32..141 217 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14338-PA 339 GG14338-PA 1..339 1..337 1343 96.5 Plus
Dere\GG10662-PA 435 GG10662-PA 41..231 32..219 432 47 Plus
Dere\GG21149-PA 509 GG21149-PA 19..178 4..147 275 40.5 Plus
Dere\GG11450-PA 205 GG11450-PA 16..133 32..143 219 38.1 Plus
Dere\GG12207-PA 195 GG12207-PA 14..179 32..182 214 32.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20825-PA 456 GH20825-PA 41..238 32..217 451 48.2 Plus
Dgri\GH12946-PA 141 GH12946-PA 1..65 1..65 305 90.9 Plus
Dgri\GH10835-PA 523 GH10835-PA 51..178 32..147 262 41.9 Plus
Dgri\GH19452-PA 217 GH19452-PA 16..132 32..141 212 39.3 Plus
Dgri\GH18148-PA 210 GH18148-PA 14..136 32..141 207 36.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
h-PB 337 CG6494-PB 1..337 1..337 1712 100 Plus
h-PA 337 CG6494-PA 1..337 1..337 1712 100 Plus
dpn-PA 435 CG8704-PA 41..231 32..219 411 47 Plus
Side-PA 507 CG10446-PA 19..388 4..290 282 27.8 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 14..179 32..182 219 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12920-PA 368 GI12920-PA 1..368 1..337 1066 74.2 Plus
Dmoj\GI20925-PA 473 GI20925-PA 41..241 32..216 416 45.1 Plus
Dmoj\GI17350-PA 528 GI17350-PA 51..178 32..147 264 43.4 Plus
Dmoj\GI24686-PA 217 GI24686-PA 16..132 32..141 211 40.2 Plus
Dmoj\GI22910-PA 210 GI22910-PA 14..137 32..141 198 34.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10333-PA 354 GL10333-PA 1..354 1..337 1132 82.2 Plus
Dper\GL10878-PA 439 GL10878-PA 41..236 32..219 423 44.4 Plus
Dper\GL18909-PA 497 GL18909-PA 52..179 32..147 265 43.4 Plus
Dper\GL21815-PA 214 GL21815-PA 16..131 32..141 215 37.9 Plus
Dper\GL22021-PA 200 GL22021-PA 14..137 32..141 198 34.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19636-PA 354 GA19636-PA 1..354 1..337 1107 81.1 Plus
Dpse\GA21268-PA 450 GA21268-PA 41..236 32..219 421 44.4 Plus
Dpse\GA10322-PA 497 GA10322-PA 52..179 32..147 266 43.4 Plus
Dpse\GA20996-PA 214 GA20996-PA 16..131 32..141 214 37.9 Plus
Dpse\GA13073-PA 200 GA13073-PA 14..137 32..141 198 34.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25080-PA 337 GM25080-PA 1..337 1..337 1753 99.4 Plus
Dsec\GM20707-PA 435 GM20707-PA 41..231 32..219 435 47 Plus
Dsec\GM17313-PA 507 GM17313-PA 19..178 4..147 275 40.5 Plus
Dsec\GM10206-PA 195 GM10206-PA 14..137 32..141 219 37.1 Plus
Dsec\GM10294-PA 205 GM10294-PA 16..133 32..143 216 38.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\h-PA 337 GD14118-PA 1..337 1..337 1758 99.7 Plus
Dsim\GD15288-PA 435 GD15288-PA 41..231 32..219 433 47 Plus
Dsim\GD24173-PA 507 GD24173-PA 19..178 4..147 275 40.5 Plus
Dsim\HLHmgamma-PA 205 GD21258-PA 16..133 32..143 216 38.1 Plus
Dsim\HLHmbeta-PA 195 GD18157-PA 14..179 32..182 214 32.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\h-PA 379 GJ13064-PA 1..379 1..337 1063 74.4 Plus
Dvir\GJ20653-PA 555 GJ20653-PA 138..329 34..216 440 47.9 Plus
Dvir\GJ16129-PA 515 GJ16129-PA 51..179 32..147 272 44.1 Plus
Dvir\GJ23903-PA 217 GJ23903-PA 16..132 32..141 212 40.2 Plus
Dvir\GJ23323-PA 209 GJ23323-PA 14..136 32..141 207 36.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\h-PA 380 GK16728-PA 1..380 1..337 1188 79.2 Plus
Dwil\GK15770-PA 465 GK15770-PA 41..233 32..217 434 47.1 Plus
Dwil\GK24825-PA 514 GK24825-PA 19..181 4..147 269 39.2 Plus
Dwil\GK14455-PA 209 GK14455-PA 16..132 32..141 213 37.6 Plus
Dwil\GK14459-PA 200 GK14459-PA 14..126 32..141 200 43.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20765-PA 338 GE20765-PA 1..338 1..337 1359 98.5 Plus
Dyak\GE23198-PA 435 GE23198-PA 41..231 32..219 434 47 Plus
Dyak\GE13222-PA 507 GE13222-PA 19..178 4..147 275 40.5 Plus
Dyak\HLHmgamma-PA 205 GE23644-PA 16..133 32..143 220 38.1 Plus
Dyak\HLHmbeta-PA 195 GE10652-PA 14..179 32..182 219 32.5 Plus

RE40955.hyp Sequence

Translation from 289 to 1302

> RE40955.hyp
MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNC
LNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAAD
PKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQ
QRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGM
QVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAA
QQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYE
PMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPW*

RE40955.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
h-PB 337 CG6494-PB 1..337 1..337 1712 100 Plus
h-PA 337 CG6494-PA 1..337 1..337 1712 100 Plus
dpn-PA 435 CG8704-PA 41..231 32..219 411 47 Plus
Side-PA 507 CG10446-PA 19..388 4..290 282 27.8 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 14..179 32..182 219 32.5 Plus