Clone RE43108 Report

Search the DGRC for RE43108

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:431
Well:8
Vector:pFlc-1
Associated Gene/TranscriptCG32473-RB
Protein status:RE43108.pep: gold
Sequenced Size:3025

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32473-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE43108.complete Sequence

3025 bp assembled on 2009-09-15

GenBank Submission: BT099748.1

> RE43108.complete
ACACTGTTCTGTGCTTTTTAGAGACTGATAGAATTAATAATATTGGCCTT
CTTATTGATAATTTATTCGCACACAAAACCTAGATAATCGCTTTTACACG
ACTCAAGTGCCAACCAGCAAAAAATCGAGCATAATGGCAACTGTGGCGCC
CGCTGTAAAAGCCGCGAGCAAGGTGCTCCAGAATCTGGGATTCCGGCTGC
CCAAACAGATTAAGCCAAGCAAGTACCGCCTTCATTTGCGCCCCGATCTC
GAACGAAAGAACTATTCCGGCAATATAAGCATCAGCCTGCAAGTACTGGA
GCCCATAGCCTTCATCCCAGTCCATGTGAAGCAACTGAATGTGAGCACCG
TTGAGGTGAAGCGCCTGGATGAATCTGGAGCGCCGCTTAAGGACATCACC
CCCACGCTGACCTTTGCCCATCCGGAGTTTGAGTACTGGGTGACCGAGTT
CGAACAGCCGCTGGAGGCGGGAAACTACTCACTGCTGCTCAACTTTACGG
GATCGCTTGTAGATCGGATTACGGGGATGTACCAGAGCTCCTACTTGGAT
AAGCTGAAAAACCGCTCCAGATCAATCATTTCCACAAAGTTTGAGCCCAC
TTATGCCCGCCAAGCATTCCCCTGCTTCGATGAGCCCGCCCTTAAGGCTC
AGTTCACCATAACGGTGGCCCGTCCAAGTGGTGATGAGTACCATGTGCTG
TCCAACATGCCAGTGGCCAGCGAGTATGTCGATGGCGATATCACCGAGGT
GACTTTCGCGGAGACCGTACCCATGAGCACCTATCTGGCCGCCTTTGTGG
TGTCTGATTTTCAATACAAGGAAACCACTGTGGAGGGAACCAGCATCGCT
CTGAAAGTCTATGCGCCACCAGCGCAGGTGGAGAAAACCCAGTACGCCCT
GGACACTGCGGCCGGAGTGATGGCCTACTACATCAACTATTTCAATGTTT
CGTATGCCCTACCCAAATTGGATCTGGTTGCCATACCCGATTTCGTGTCC
GGTGCTATGGAAAACTGGGGATTGGTCACGTTCCGGGAGACGGCTCTTCT
GTACGACGAATCTACCAGTTCCAGCGTGAATAAGCAGCGTGTGGCCATCG
TCGTGGCCCATGAGTTGGCTCACCAGTGGTTCGGAAACCTGGTAACCATG
AACTGGTGGAACGATTTGTGGCTAAACGAGGGTTTCGCATCATTCCTTGA
GTACAAGGGAGTAAAGCAAATGCATCCGGAATGGGATATGGACAATCAGT
TTGTTATTGAGGAACTGCACCCGGTGCTGACCATTGATGCCACCTTAGCC
TCCCATCCGATTGTCAAGTCCATTGAGAGTCCAGCCGAGATCACGGAGTA
CTTCGATACCATCACCTATTCAAAGGGAGCCGCCTTAGTACGCATGCTTG
AGAATCTGGTGGGCGAGGAAAAGTTGAGGAACGCCACCACCCGCTATTTG
GTGCGTCATATCTACAGTACTGCCACCACCGAGGATTACCTCACCGCAGT
CGAGGAGGAGGAGGGCCTGGAATTTGACGTGAAGCAGATCATGCAGACCT
GGACGGAGCAGATGGGTCTTCCGGTTGTGGAGGTGGAGAAAAGTGGCAGT
ACTTATAAGCTCACCCAAAAGCGTTTCCTGGCCAACGAAGATGACTACGC
AGCCGAAGCTGAAGCATCGTCCTTCAACTACCGTTGGTCGATTCCCATTA
CCTACACGAGCAGCATCAACAGTGAAGTCCAATCACTAATATTCAACCAC
AATGACAATGAGGCCACCATAACGCTTCCGGAAGAGGCCAGCTGGATTAA
GATTAACACGAATCAAGTGGGCTACTACCGGGTGAACTACGGCAGCGAAC
AGTGGGCGGAACTCATATCGGCCCTGAAGAACTCCCGGGAAACCTTCAGC
ACCGCCGATCGCGCTCATCTGCTGAACGATGCCAATACCCTGGCCGCTGC
CGGACAGCTTAACTACTCCGTGGCACTGGATCTGATATCTTACCTGGAGA
GCGAGCAGGACTACGTGCCCTGGAGCGTAGGCACCTCCGCCCTGGCTACG
TTAAGGAACCGCGTATACTACACGGACTTGTACACTAATTACACCACCTA
CGCCCGTAAACTGCTTACGCCCATCGTAGAAAAGGTCACGTTTACCGTGG
CAGCCGATCATCTGGAAAATCGCCTCCGTATTAAGGTGCTGAGCTCAGCC
TGCAGCTTGGGACATGAGAGCTCCTTGCAACAGGCGGTCACGCTCTTCAA
CCAGTGGCTAGCCAGCCCCGAGACCCGGCCCAATCCGGATATCCGAGACG
TTGTCTACTACTATGGTCTGCAACAGGTGAACACAGAGGCTGCCTGGGAT
CAAGTTTGGAAGCTGTATCTGGACGAGAGTGATGCCCAGGAAAAGCTGAA
GTTGATGAACTGCCTAACCGCCGTGCAGGTGCCATGGCTGTTGCAGCGTT
ACATCAACTGGGCCTGGGATGAGAGCAATGTCCGCCGCCAGGACTACTTC
ACCCTGCTTGGATATATATCCACCAATCCGGTGGGTCAGAGTCTTGTGTG
GGATTACGTGCGTGAAAACTGGGAGAAGTTGGTGGATCGTTTCGGCATCA
ATGAACGCACCTTGGGTCGTCTGATCCCCACGATCACTGCCCGCTTCTCA
ACAGAAACCAAGCTGGAAGAGATGCAGCAGTTCTTTGCCAAATATCCCGA
GGCTGGAGCCGGAACTGCGGCCCGTCAACAGGCGTTGGAAGCGGTGAAGG
CAAACATCAAATGGCTAGCGGCCAACAAGGCCCAGGTGGGCGAATGGTTG
GCCAATTACGTTCAACAGTCCAGCGTCACCAACCGCATTCAGTGAGCCCT
AAACTCGGCCATTTGCACCTTGTAAAATATCAGTAATGTAAAAACTACCA
ATGGAAGTGACTATAGTCTTAGCTAATTAGTGAAGCAAAAGCATTTCAAA
TGTAAACGAAGAATTGTGATTGCTTATGATATTTTTGAAGAAAATACAAG
TGAAAAAATAAAAAAAAAAAAAAAA

RE43108.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RB 3067 CG32473-RB 66..3067 1..3002 15010 100 Plus
CG32473-RC 3731 CG32473-RC 809..3731 82..3004 14615 100 Plus
CG32473.a 3722 CG32473.a 800..3722 82..3004 14615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 11:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9135276..9136242 568..1534 4640 98.7 Plus
chr3R 27901430 chr3R 9137086..9137925 2170..3009 4170 99.8 Plus
chr3R 27901430 chr3R 9134568..9135084 54..570 2540 99.4 Plus
chr3R 27901430 chr3R 9136537..9137028 1678..2169 2445 99.8 Plus
chr3R 27901430 chr3R 9136307..9136450 1534..1677 690 98.6 Plus
chr3R 27901430 chr3R 9138474..9138706 1167..1410 595 84.8 Plus
chr3R 27901430 chr3R 9138852..9139115 1678..1959 545 81.2 Plus
chr3R 27901430 chr3R 25069963..25070071 1188..1080 335 87.2 Minus
chr3R 27901430 chr3R 9125511..9125595 1104..1188 290 89.4 Plus
chr3R 27901430 chr3R 9123006..9123241 2489..2724 280 74.6 Plus
chr3R 27901430 chr3R 9138706..9138780 1447..1521 270 90.7 Plus
chr3R 27901430 chr3R 9121083..9121263 962..1142 245 75.7 Plus
chr3R 27901430 chr3R 24966342..24966442 1082..1182 220 81.2 Plus
chr3R 27901430 chr3R 25065409..25065488 1188..1109 220 85 Minus
chr3R 27901430 chr3R 25059694..25059773 1182..1103 205 83.8 Minus
chr3R 27901430 chr3R 9134536..9134576 1..41 190 97.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RC 3078 CG32473-PC 315..3078 82..2845 13820 100 Plus
CG32473-RB 2712 CG32473-PB 1..2712 134..2845 13560 100 Plus
CG32473-RA 3039 CG32473-PA 763..3039 569..2845 11385 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:56:44 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-RB 3002 CG32473-RB 1..3002 1..3002 15010 100 Plus
CG32473-RC 3635 CG32473-RC 715..3635 82..3002 14605 100 Plus
CG32473-RA 3273 CG32473-RA 840..3273 569..3002 12170 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 11:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PC 1025 CG32473-PC 106..1025 83..2842 4637 100 Plus
CG32473-PB 903 CG32473-PB 1..903 134..2842 4550 100 Plus
CG32473-PA 1012 CG32473-PA 107..1012 110..2842 3898 86.9 Plus
CG8773-PB 994 CG8773-PB 98..989 113..2800 2516 55.5 Plus
CG8774-PB 885 CG8774-PB 9..885 191..2839 2112 47.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13310143..13311109 568..1534 4835 100 Plus
3R 32079331 3R 13311953..13312794 2170..3011 4210 100 Plus
3R 32079331 3R 13309386..13309955 1..570 2850 100 Plus
3R 32079331 3R 13311404..13311895 1678..2169 2460 100 Plus
3R 32079331 3R 13311174..13311317 1534..1677 720 100 Plus
3R 32079331 3R 13313341..13313573 1167..1410 595 84.8 Plus
3R 32079331 3R 13313710..13313973 1678..1959 545 81.2 Plus
3R 32079331 3R 29247180..29247288 1188..1080 320 86.2 Minus
3R 32079331 3R 13300347..13300431 1104..1188 305 90.6 Plus
3R 32079331 3R 13297841..13298076 2489..2724 280 74.6 Plus
3R 32079331 3R 13295918..13296098 962..1142 245 75.7 Plus
3R 32079331 3R 29242633..29242712 1188..1109 220 85 Minus
3R 32079331 3R 29236928..29237007 1182..1103 205 83.8 Minus
3R 32079331 3R 29143469..29143569 1082..1182 190 79.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13050974..13051940 568..1534 4835 100 Plus
3R 31820162 3R 13052784..13053625 2170..3011 4210 100 Plus
3R 31820162 3R 13050217..13050786 1..570 2850 100 Plus
3R 31820162 3R 13052235..13052726 1678..2169 2460 100 Plus
3R 31820162 3R 13052005..13052148 1534..1677 720 100 Plus
3R 31820162 3R 13054172..13054366 1167..1366 585 87 Plus
3R 31820162 3R 13054541..13054722 1678..1862 525 86.4 Plus
3R 31820162 3R 28988011..28988119 1188..1080 320 86.2 Minus
3R 31820162 3R 13041178..13041262 1104..1188 305 90.5 Plus
3R 31820162 3R 13038804..13038907 2621..2724 265 83.6 Plus
3R 31820162 3R 13036749..13036929 962..1142 245 75.6 Plus
3R 31820162 3R 13054728..13054804 1883..1959 235 87 Plus
3R 31820162 3R 28983464..28983543 1188..1109 220 85 Minus
3R 31820162 3R 28977759..28977838 1182..1103 205 83.7 Minus
3R 31820162 3R 28884300..28884400 1082..1182 190 79.2 Plus
3R 31820162 3R 13037000..13037062 1142..1204 180 85.7 Plus
3R 31820162 3R 13054906..13054955 2959..3007 165 92 Plus
3R 31820162 3R 13041037..13041130 963..1056 140 76.5 Plus
3R 31820162 3R 28883758..28883818 588..648 140 81.9 Plus
Blast to na_te.dros performed on 2014-11-27 11:19:57 has no hits.

RE43108.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:22:57 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9137086..9137925 2170..3009 99   Plus
chr3R 9136537..9137028 1678..2169 99 -> Plus
chr3R 9136307..9136450 1534..1677 98 -> Plus
chr3R 9135279..9136241 571..1533 98 -> Plus
chr3R 9134572..9135084 58..570 99 -> Plus
chr3R 9134536..9134571 1..36 97 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:28 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RC 315..3078 82..2845 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:12:25 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RC 315..3078 82..2845 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:48 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RC 315..3078 82..2845 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:22:57 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RC 315..3078 82..2845 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-15 17:04:56 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RB 1..3009 1..3009 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:12:24 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RB 1..3002 1..3002 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:48 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RB 1..3002 1..3002 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:22:57 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
CG32473-RB 1..3002 1..3002 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:22:57 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13311953..13312792 2170..3009 100   Plus
3R 13311404..13311895 1678..2169 100 -> Plus
3R 13311174..13311317 1534..1677 100 -> Plus
3R 13310146..13311108 571..1533 100 -> Plus
3R 13309386..13309955 1..570 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:48 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9137675..9138514 2170..3009 100   Plus
arm_3R 9137126..9137617 1678..2169 100 -> Plus
arm_3R 9136896..9137039 1534..1677 100 -> Plus
arm_3R 9135868..9136830 571..1533 100 -> Plus
arm_3R 9135108..9135677 1..570 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:03:20 Download gff for RE43108.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13052784..13053623 2170..3009 100   Plus
3R 13052235..13052726 1678..2169 100 -> Plus
3R 13052005..13052148 1534..1677 100 -> Plus
3R 13050977..13051939 571..1533 100 -> Plus
3R 13050217..13050786 1..570 100 -> Plus

RE43108.pep Sequence

Translation from 133 to 2844

> RE43108.pep
MATVAPAVKAASKVLQNLGFRLPKQIKPSKYRLHLRPDLERKNYSGNISI
SLQVLEPIAFIPVHVKQLNVSTVEVKRLDESGAPLKDITPTLTFAHPEFE
YWVTEFEQPLEAGNYSLLLNFTGSLVDRITGMYQSSYLDKLKNRSRSIIS
TKFEPTYARQAFPCFDEPALKAQFTITVARPSGDEYHVLSNMPVASEYVD
GDITEVTFAETVPMSTYLAAFVVSDFQYKETTVEGTSIALKVYAPPAQVE
KTQYALDTAAGVMAYYINYFNVSYALPKLDLVAIPDFVSGAMENWGLVTF
RETALLYDESTSSSVNKQRVAIVVAHELAHQWFGNLVTMNWWNDLWLNEG
FASFLEYKGVKQMHPEWDMDNQFVIEELHPVLTIDATLASHPIVKSIESP
AEITEYFDTITYSKGAALVRMLENLVGEEKLRNATTRYLVRHIYSTATTE
DYLTAVEEEEGLEFDVKQIMQTWTEQMGLPVVEVEKSGSTYKLTQKRFLA
NEDDYAAEAEASSFNYRWSIPITYTSSINSEVQSLIFNHNDNEATITLPE
EASWIKINTNQVGYYRVNYGSEQWAELISALKNSRETFSTADRAHLLNDA
NTLAAAGQLNYSVALDLISYLESEQDYVPWSVGTSALATLRNRVYYTDLY
TNYTTYARKLLTPIVEKVTFTVAADHLENRLRIKVLSSACSLGHESSLQQ
AVTLFNQWLASPETRPNPDIRDVVYYYGLQQVNTEAAWDQVWKLYLDESD
AQEKLKLMNCLTAVQVPWLLQRYINWAWDESNVRRQDYFTLLGYISTNPV
GQSLVWDYVRENWEKLVDRFGINERTLGRLIPTITARFSTETKLEEMQQF
FAKYPEAGAGTAARQQALEAVKANIKWLAANKAQVGEWLANYVQQSSVTN
RIQ*

RE43108.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17593-PA 1027 GF17593-PA 125..1027 1..903 4181 84.4 Plus
Dana\GF17590-PA 974 GF17590-PA 86..969 2..889 2504 53.3 Plus
Dana\GF17591-PA 938 GF17591-PA 64..934 17..889 2131 47.1 Plus
Dana\GF23291-PA 991 GF23291-PA 105..987 21..891 1345 34.8 Plus
Dana\GF22895-PA 926 GF22895-PA 27..919 20..886 1283 34.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19578-PA 1025 GG19578-PA 143..1025 16..903 4002 85.7 Plus
Dere\GG19555-PA 1001 GG19555-PA 112..996 2..889 2629 55.4 Plus
Dere\GG19567-PA 942 GG19567-PA 64..931 18..891 2135 46.7 Plus
Dere\GG11647-PA 999 GG11647-PA 113..998 21..894 1365 35 Plus
Dere\GG12023-PA 926 GG12023-PA 27..918 20..885 1302 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18430-PA 1011 GH18430-PA 130..1010 16..902 3342 70.3 Plus
Dgri\GH18428-PA 957 GH18428-PA 77..957 16..897 2490 52.8 Plus
Dgri\GH18429-PA 1989 GH18429-PA 1224..1978 139..891 2120 52.8 Plus
Dgri\GH18429-PA 1989 GH18429-PA 34..694 14..681 1626 46.6 Plus
Dgri\GH18429-PA 1989 GH18429-PA 688..1230 139..681 1497 52.4 Plus
Dgri\GH17454-PA 1006 GH17454-PA 111..994 21..889 1312 34 Plus
Dgri\GH16241-PA 1007 GH16241-PA 149..1002 21..889 1256 33.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PB 903 CG32473-PB 1..903 1..903 4675 100 Plus
CG32473-PC 1025 CG32473-PC 123..1025 1..903 4675 100 Plus
CG32473-PA 1012 CG32473-PA 130..1012 16..903 4014 88.7 Plus
CG8773-PB 994 CG8773-PB 117..989 16..889 2581 56.4 Plus
CG8774-PB 885 CG8774-PB 9..885 20..902 2158 47.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24331-PA 1016 GI24331-PA 138..1015 20..902 3370 71.6 Plus
Dmoj\GI24329-PA 959 GI24329-PA 76..952 16..889 2498 53.8 Plus
Dmoj\GI24330-PA 940 GI24330-PA 48..929 9..891 2219 49 Plus
Dmoj\GI22778-PA 1004 GI22778-PA 113..995 21..889 1288 33.1 Plus
Dmoj\GI22347-PA 930 GI22347-PA 26..918 20..886 1268 33.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24466-PA 1025 GL24466-PA 146..1024 20..902 3643 77.7 Plus
Dper\GL24464-PA 976 GL24464-PA 86..973 1..891 2589 55.1 Plus
Dper\GL24465-PA 945 GL24465-PA 64..945 17..902 2169 46.9 Plus
Dper\GL23913-PA 983 GL23913-PA 105..983 21..896 1354 35.1 Plus
Dper\GL22605-PA 1001 GL22605-PA 139..998 16..889 1262 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16930-PB 1026 GA16930-PB 123..1025 1..902 4166 84.9 Plus
Dpse\GA16930-PC 904 GA16930-PC 1..903 1..902 4160 84.9 Plus
Dpse\GA16930-PD 1015 GA16930-PD 136..1014 20..902 3649 78 Plus
Dpse\GA21310-PA 982 GA21310-PA 105..979 16..891 2576 55.5 Plus
Dpse\GA21311-PA 945 GA21311-PA 64..934 17..891 2161 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24100-PA 565 GM24100-PA 1..565 339..903 2981 98.6 Plus
Dsec\GM24097-PA 1002 GM24097-PA 135..997 16..889 2577 55.7 Plus
Dsec\GM24098-PA 942 GM24098-PA 66..931 20..891 2198 48 Plus
Dsec\GM12769-PA 999 GM12769-PA 113..998 21..894 1362 34.5 Plus
Dsec\GM12249-PA 927 GM12249-PA 27..918 20..884 1295 34 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18897-PA 790 GD18897-PA 132..789 16..678 2899 84.3 Plus
Dsim\GD18895-PA 966 GD18895-PA 135..961 16..889 2442 53.8 Plus
Dsim\GD18896-PA 942 GD18896-PA 66..931 20..891 2202 48.2 Plus
Dsim\GD17862-PA 927 GD17862-PA 27..918 20..884 1292 33.6 Plus
Dsim\GD17873-PA 924 GD17873-PA 25..916 20..885 1267 33.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10417-PA 1017 GJ10417-PA 139..1016 20..902 3433 72.9 Plus
Dvir\GJ10415-PA 956 GJ10415-PA 66..948 3..889 2503 53.5 Plus
Dvir\GJ10416-PA 954 GJ10416-PA 66..943 13..891 2275 48.9 Plus
Dvir\GJ22781-PA 1004 GJ22781-PA 113..995 21..889 1302 34.2 Plus
Dvir\GJ11001-PA 930 GJ11001-PA 22..928 20..900 1285 33.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13936-PA 1009 GK13936-PA 127..1009 16..903 3392 70.4 Plus
Dwil\GK13934-PA 970 GK13934-PA 148..970 16..838 2295 52.6 Plus
Dwil\GK13935-PA 945 GK13935-PA 68..941 18..891 2145 47.4 Plus
Dwil\GK11892-PA 1015 GK11892-PA 128..1008 21..889 1326 34.4 Plus
Dwil\GK16986-PA 1007 GK16986-PA 132..1004 2..889 1273 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26262-PA 1025 GE26262-PA 123..1025 1..903 4733 97.1 Plus
Dyak\GE26259-PA 977 GE26259-PA 106..972 16..889 2571 55.7 Plus
Dyak\GE26260-PA 942 GE26260-PA 64..929 18..889 2187 48 Plus
Dyak\GE23837-PA 999 GE23837-PA 113..998 21..894 1361 34.7 Plus
Dyak\GE10460-PA 935 GE10460-PA 35..923 20..881 1281 34.3 Plus

RE43108.hyp Sequence

Translation from 133 to 2844

> RE43108.hyp
MATVAPAVKAASKVLQNLGFRLPKQIKPSKYRLHLRPDLERKNYSGNISI
SLQVLEPIAFIPVHVKQLNVSTVEVKRLDESGAPLKDITPTLTFAHPEFE
YWVTEFEQPLEAGNYSLLLNFTGSLVDRITGMYQSSYLDKLKNRSRSIIS
TKFEPTYARQAFPCFDEPALKAQFTITVARPSGDEYHVLSNMPVASEYVD
GDITEVTFAETVPMSTYLAAFVVSDFQYKETTVEGTSIALKVYAPPAQVE
KTQYALDTAAGVMAYYINYFNVSYALPKLDLVAIPDFVSGAMENWGLVTF
RETALLYDESTSSSVNKQRVAIVVAHELAHQWFGNLVTMNWWNDLWLNEG
FASFLEYKGVKQMHPEWDMDNQFVIEELHPVLTIDATLASHPIVKSIESP
AEITEYFDTITYSKGAALVRMLENLVGEEKLRNATTRYLVRHIYSTATTE
DYLTAVEEEEGLEFDVKQIMQTWTEQMGLPVVEVEKSGSTYKLTQKRFLA
NEDDYAAEAEASSFNYRWSIPITYTSSINSEVQSLIFNHNDNEATITLPE
EASWIKINTNQVGYYRVNYGSEQWAELISALKNSRETFSTADRAHLLNDA
NTLAAAGQLNYSVALDLISYLESEQDYVPWSVGTSALATLRNRVYYTDLY
TNYTTYARKLLTPIVEKVTFTVAADHLENRLRIKVLSSACSLGHESSLQQ
AVTLFNQWLASPETRPNPDIRDVVYYYGLQQVNTEAAWDQVWKLYLDESD
AQEKLKLMNCLTAVQVPWLLQRYINWAWDESNVRRQDYFTLLGYISTNPV
GQSLVWDYVRENWEKLVDRFGINERTLGRLIPTITARFSTETKLEEMQQF
FAKYPEAGAGTAARQQALEAVKANIKWLAANKAQVGEWLANYVQQSSVTN
RIQ*

RE43108.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG32473-PB 903 CG32473-PB 1..903 1..903 4675 100 Plus
CG32473-PC 1025 CG32473-PC 123..1025 1..903 4675 100 Plus
CG32473-PA 1012 CG32473-PA 130..1012 16..903 4014 88.7 Plus
CG8773-PB 994 CG8773-PB 117..989 16..889 2581 56.4 Plus
CG8774-PB 885 CG8774-PB 9..885 20..902 2158 47.6 Plus