Clone RE44406 Report

Search the DGRC for RE44406

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:444
Well:6
Vector:pFlc-1
Associated Gene/TranscriptAtg4b-RA
Protein status:RE44406.pep: gold
Sequenced Size:2652

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6194-RA 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE44406.complete Sequence

2652 bp assembled on 2009-10-16

GenBank Submission: BT100116.1

> RE44406.complete
ATGGGCAATTGTACTTCTCGCGAATAAGAAAAACAAATTTCGTGGAGTTA
CTTTATCTTATTTTGTCAACAAATAAACGATGAACTATGACGGCCTCCTT
TCCAAGTTGACCGACGAAAAACTGATGCTCTTCGAAGCCGCCGGCGAGGG
GACCATTGTAGAGGGTAGCCGGATATGCGGCCAGGATGCGGATCCGCTCT
CCTTGCCGCTGGTGGAGGACGGCGCCATCGAGGAGGAGCAGGCGGCCCCC
ATACAGACGATTCATCGCACTGTATTCGCCGTTCCACGCGTCCCTTCCCC
CTCCCCCGTAAGCACATCAGGTGCCAATCTGAACCTCAAGACGGAAAACG
CTGCGACAGCGACTCCGCAGCGCAAAATATCGACGTCATCACGTTTCATG
AACGCCTTCAGTCAGCTCTACGGCGGCGGCAACAGCGGTCCGAGCTGCGG
TCACGTGGAGCAGCACAACGAGGAACCCGGTGACCTGTCGGCAAACCGTA
CTCCCACCAAGGGCATGGAGTCCAAGCTCGTCGCAATGTGGCACAATGTG
AAGTATGGCTGGAGCGGCAAGATGAGGCAGACCAGCTTCTCAAAGGAGCA
GCCCGTGTGGCTGCTAGGACGGTGCTATCATCGACGCTTTACTCCGCCCG
TAAGCATGGAAAGTTCCATCACCGAGCTGCCCAGCGGGGCGGATACCACC
CCCGATAACGCCACATCGGCGTTCGACAGCATTCAGGCCACATCGACATC
AACCTCCTTGTATCCAGCCCTTAATCCGCAGCAGATCGATGAGATTGTGG
TGCCCCAGGAACTGGGAATGGACGCGGTGGAGAACCAAGTGGGCGAACAG
CCTTGGGAGGAGGGCATCGAAGGCTTTCGTCGTGACTTTTACAGTAGGAT
TTGGATGACCTACCGTCGAGAGTTCCCAATAATGAATGGCTCCAACTACA
CCTCGGACTGCGGTTGGGGCTGTATGCTAAGGAGTGGTCAGATGCTCTTC
GCTCAAGGACTCATCTGTCACTTCCTAGGGCGAAGCTGGCGCTATGATTC
AGAGTCCCAGTTGCACTCGACTTACGAGGACAATATGCATAAGAAGATCG
TCAAGTGGTTCGGGGACAGTTCCTCAAAAAGCAGTCCCTTCTCCATCCAC
GCCCTGGTGCGGCTGGGGGAGCATTTGGGTAAAAAACCTGGCGATTGGTA
CGGTCCCGCCTCTGTTTCCTATTTGCTTAAACACGCCTTAGAGCACGCGG
CTCAGGAAAATGCAGACTTTGACAATATTAGTGTCTATGTAGCCAAAGAT
TGCACGATTTACTTGCAAGATATTGAGGATCAATGCAGCATTCCGGAACC
GGCGCCAAAACCCCATGTGCCTTGGCAACAAGCGAAGCGGCCGCAGGCGG
AAACTACCAAAACGGAGCAACAACAGCACTGGAAGTCCCTCATCGTTCTG
ATACCTTTGCGCCTGGGCAGTGATAAACTGAATCCTGTGTATGCCCATTG
TCTGAAGCTGCTGCTGAGTACAGAACACTGCCTGGGCATCCTTGGTGGAA
AGCCAAAGCATTCGCTGTACTTTGTCGGCTTCCAGGAGGACAGGCTCATC
CACTTGGATCCGCACTATTGCCAGGAGATGGTGGATGTGAACCAAGAGAA
CTTCTCCCTGCACTCGTTTCACTGCAAGTCGCCGCGGAAGCTTAAGGCCA
GCAAAATGGATCCTAGTTGTTGTATCGGCTTTTACTGTGCCACCAAAAGT
GATTTCGACAATTTTATGGAGAGCGTACAGTTGTATTTGCATCCTATGCG
TTGCGCCTCAGGGGCAACTGTGGATAAGGCGGCCGGGAGCCATCATACGA
CGCCTCAGTCATCCCATCAAACCGAGCAAACAGAGATGAACTATCCATTG
TTCTCATTTTCCCGCGGTCGTTGCATGGATCACGAGCGGGACGAAATGAG
CGATTCGCTGTACAAGCCGCTCATAAAACAGGTGGCTTCTCTGGCCCAGG
AATTGGGCGCTCAACTGGCGCCGCCACAGCACGGCGATGAGCACGACCAA
GATGATAGTGAAAGCGAAGAGTTTGTGCTGCTGTAGATCGTTGCCGCCAC
CACCACATAACCCTGTTGCTGTGCTAGCTGTGTTATTTGCTCATTATTAT
TTGATTTAGTTGCCAGCCGCTGCTGCTTGCTTGCTCGCCCAGAAAAACCC
AACAGACCCGTATCTCAAACACAAAGACTTTGTTGTACCTTTACGCCTAC
GCATATAGTACATAGACGCATGCATGTATCTTGAATATTTACTGATGTCC
ACGTTAATCTCTCTTTTGTTCGACCTGTCGTCTCGCATTCTGCCAAAGTT
TTTCAGCTATTTCCATGTTCGAGCAGCCCGATCTGTTTATATGTGTTATA
TATAAACCTATGTAATTTGCGGTATTATTATTTTAAAATCATGAATCTTT
AATGGAATTGAATTATTTTACAATGGTGCCACAATTGTCACTATTCTTTG
AAGTATTTCATGTAGCGCTTAGTTCTAGAGTTTAGTTAAATTATGTAAGT
CGTCTTGTAATTGTTCGATCATTATTTAGTTTTAACATTAATTGTATATA
CCCTCGAGTAAATGAATAAACTATCCTAACTTATACAAAAAAAAAAAAAA
AA

RE44406.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG6194-RA 2839 CG6194-RA 131..2767 4..2640 13170 99.9 Plus
CG5038-RA 2700 CG5038-RA 2490..2700 2640..2430 1040 99.5 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11180308..11181264 1035..79 4785 100 Minus
chr3R 27901430 chr3R 11178355..11179208 2636..1783 4270 100 Minus
chr3R 27901430 chr3R 11179268..11179743 1783..1308 2365 99.8 Minus
chr3R 27901430 chr3R 11180055..11180250 1230..1035 980 100 Minus
chr3R 27901430 chr3R 11179911..11179987 1307..1231 385 100 Minus
chr3R 27901430 chr3R 11181448..11181527 83..4 385 98.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-RA 2007 CG6194-PA 1..2007 80..2086 10035 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:57:26 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-RA 2665 CG6194-RA 33..2665 4..2636 13165 100 Plus
CG5038-RA 2702 CG5038-RA 2496..2702 2636..2430 1035 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-PA 668 CG6194-PA 1..668 80..2083 3344 100 Plus
Atg4a-PB 410 CG4428-PB 63..333 866..1780 437 32.9 Plus
Atg4a-PA 411 CG4428-PA 63..333 866..1780 437 32.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15355673..15356629 1035..79 4785 100 Minus
3R 32079331 3R 15353716..15354573 2640..1783 4275 99.9 Minus
3R 32079331 3R 15354633..15355108 1783..1308 2380 100 Minus
3R 32079331 3R 15355420..15355615 1230..1035 980 100 Minus
3R 32079331 3R 15355276..15355352 1307..1231 385 100 Minus
3R 32079331 3R 15356813..15356892 83..4 385 98.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15096504..15097460 1035..79 4785 100 Minus
3R 31820162 3R 15094547..15095404 2640..1783 4275 99.8 Minus
3R 31820162 3R 15095464..15095939 1783..1308 2380 100 Minus
3R 31820162 3R 15096251..15096446 1230..1035 980 100 Minus
3R 31820162 3R 15096107..15096183 1307..1231 385 100 Minus
3R 31820162 3R 15097644..15097723 83..4 385 98.7 Minus
Blast to na_te.dros performed on 2014-11-27 02:31:59 has no hits.

RE44406.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:56:37 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11181452..11181530 1..79 98   Minus
chr3R 11180309..11181263 80..1034 100 <- Minus
chr3R 11180055..11180250 1035..1230 100 <- Minus
chr3R 11179911..11179987 1231..1307 100 <- Minus
chr3R 11179268..11179743 1308..1783 99 <- Minus
chr3R 11178355..11179207 1784..2636 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:35 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 1..2007 80..2086 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:45:28 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 1..2007 80..2086 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:32 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 1..2007 80..2086 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:56:37 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
Atg4b-RA 1..2007 80..2086 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-16 17:01:07 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 25..2660 1..2636 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:45:27 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 25..2660 1..2636 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:32 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
CG6194-RA 30..2665 1..2636 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:56:37 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
Atg4b-RA 30..2665 1..2636 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:56:37 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15356817..15356895 1..79 98   Minus
3R 15355674..15356628 80..1034 100 <- Minus
3R 15355420..15355615 1035..1230 100 <- Minus
3R 15355276..15355352 1231..1307 100 <- Minus
3R 15354633..15355108 1308..1783 100 <- Minus
3R 15353720..15354572 1784..2636 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:32 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11182539..11182617 1..79 98   Minus
arm_3R 11181396..11182350 80..1034 100 <- Minus
arm_3R 11181142..11181337 1035..1230 100 <- Minus
arm_3R 11180998..11181074 1231..1307 100 <- Minus
arm_3R 11180355..11180830 1308..1783 100 <- Minus
arm_3R 11179442..11180294 1784..2636 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:50 Download gff for RE44406.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15097648..15097726 1..79 98   Minus
3R 15096505..15097459 80..1034 100 <- Minus
3R 15096251..15096446 1035..1230 100 <- Minus
3R 15096107..15096183 1231..1307 100 <- Minus
3R 15095464..15095939 1308..1783 100 <- Minus
3R 15094551..15095403 1784..2636 100 <- Minus

RE44406.pep Sequence

Translation from 79 to 2085

> RE44406.pep
MNYDGLLSKLTDEKLMLFEAAGEGTIVEGSRICGQDADPLSLPLVEDGAI
EEEQAAPIQTIHRTVFAVPRVPSPSPVSTSGANLNLKTENAATATPQRKI
STSSRFMNAFSQLYGGGNSGPSCGHVEQHNEEPGDLSANRTPTKGMESKL
VAMWHNVKYGWSGKMRQTSFSKEQPVWLLGRCYHRRFTPPVSMESSITEL
PSGADTTPDNATSAFDSIQATSTSTSLYPALNPQQIDEIVVPQELGMDAV
ENQVGEQPWEEGIEGFRRDFYSRIWMTYRREFPIMNGSNYTSDCGWGCML
RSGQMLFAQGLICHFLGRSWRYDSESQLHSTYEDNMHKKIVKWFGDSSSK
SSPFSIHALVRLGEHLGKKPGDWYGPASVSYLLKHALEHAAQENADFDNI
SVYVAKDCTIYLQDIEDQCSIPEPAPKPHVPWQQAKRPQAETTKTEQQQH
WKSLIVLIPLRLGSDKLNPVYAHCLKLLLSTEHCLGILGGKPKHSLYFVG
FQEDRLIHLDPHYCQEMVDVNQENFSLHSFHCKSPRKLKASKMDPSCCIG
FYCATKSDFDNFMESVQLYLHPMRCASGATVDKAAGSHHTTPQSSHQTEQ
TEMNYPLFSFSRGRCMDHERDEMSDSLYKPLIKQVASLAQELGAQLAPPQ
HGDEHDQDDSESEEFVLL*

RE44406.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23235-PA 668 GF23235-PA 1..668 1..668 3037 85.8 Plus
Dana\GF15159-PA 402 GF15159-PA 63..329 263..563 464 35 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20629-PA 708 GG20629-PA 38..708 1..668 3370 96.3 Plus
Dere\GG24763-PA 411 GG24763-PA 63..333 263..567 422 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:08:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16873-PA 673 GH16873-PA 1..673 1..668 2717 76.4 Plus
Dgri\GH13687-PA 393 GH13687-PA 63..335 263..567 472 33.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-PA 668 CG6194-PA 1..668 1..668 3590 100 Plus
Atg4a-PB 410 CG4428-PB 63..333 263..567 452 32.9 Plus
Atg4a-PA 411 CG4428-PA 63..333 263..567 452 32.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10728-PA 682 GI10728-PA 1..682 1..668 2760 75.1 Plus
Dmoj\GI17971-PA 382 GI17971-PA 57..329 263..567 465 33.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13755-PA 678 GL13755-PA 1..678 1..668 2956 86.5 Plus
Dper\GL15485-PA 409 GL15485-PA 63..333 263..567 421 34.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19429-PB 676 GA19429-PB 1..676 1..668 2961 87.5 Plus
Dpse\GA18177-PA 409 GA18177-PA 63..333 263..567 424 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25780-PA 703 GM25780-PA 35..703 1..668 3543 98.7 Plus
Dsec\GM16788-PA 269 GM16788-PA 1..187 351..563 259 29.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20357-PA 703 GD20357-PA 35..703 1..668 3557 99.1 Plus
Dsim\GD23066-PA 411 GD23066-PA 63..329 263..563 419 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10670-PA 672 GJ10670-PA 1..672 1..668 2710 78.1 Plus
Dvir\GJ16311-PA 397 GJ16311-PA 57..329 263..567 463 33.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11310-PA 676 GK11310-PA 1..676 1..668 2805 79 Plus
Dwil\GK24338-PA 400 GK24338-PA 57..327 263..567 422 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26385-PA 706 GE26385-PA 38..706 1..668 3458 97.6 Plus
Dyak\GE17286-PA 411 GE17286-PA 63..333 263..567 429 33.5 Plus

RE44406.hyp Sequence

Translation from 79 to 2085

> RE44406.hyp
MNYDGLLSKLTDEKLMLFEAAGEGTIVEGSRICGQDADPLSLPLVEDGAI
EEEQAAPIQTIHRTVFAVPRVPSPSPVSTSGANLNLKTENAATATPQRKI
STSSRFMNAFSQLYGGGNSGPSCGHVEQHNEEPGDLSANRTPTKGMESKL
VAMWHNVKYGWSGKMRQTSFSKEQPVWLLGRCYHRRFTPPVSMESSITEL
PSGADTTPDNATSAFDSIQATSTSTSLYPALNPQQIDEIVVPQELGMDAV
ENQVGEQPWEEGIEGFRRDFYSRIWMTYRREFPIMNGSNYTSDCGWGCML
RSGQMLFAQGLICHFLGRSWRYDSESQLHSTYEDNMHKKIVKWFGDSSSK
SSPFSIHALVRLGEHLGKKPGDWYGPASVSYLLKHALEHAAQENADFDNI
SVYVAKDCTIYLQDIEDQCSIPEPAPKPHVPWQQAKRPQAETTKTEQQQH
WKSLIVLIPLRLGSDKLNPVYAHCLKLLLSTEHCLGILGGKPKHSLYFVG
FQEDRLIHLDPHYCQEMVDVNQENFSLHSFHCKSPRKLKASKMDPSCCIG
FYCATKSDFDNFMESVQLYLHPMRCASGATVDKAAGSHHTTPQSSHQTEQ
TEMNYPLFSFSRGRCMDHERDEMSDSLYKPLIKQVASLAQELGAQLAPPQ
HGDEHDQDDSESEEFVLL*

RE44406.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Atg4b-PA 668 CG6194-PA 1..668 1..668 3590 100 Plus
Atg4a-PB 410 CG4428-PB 63..333 263..567 452 32.9 Plus
Atg4a-PA 411 CG4428-PA 63..333 263..567 452 32.9 Plus