Clone RE48874 Report

Search the DGRC for RE48874

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:488
Well:74
Vector:pFlc-1
Associated Gene/TranscriptCG17167-RD
Protein status:RE48874.pep: gold
Sequenced Size:2898

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17167-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE48874.complete Sequence

2898 bp assembled on 2011-01-10

GenBank Submission: BT125892.1

> RE48874.complete
ACTTTATTAGTTGAGCGATACTATTCTAGCCAAACGGTTTGCTGGAGTTT
GCCAGCGAGCAGCGACTCGTACAAAATCCCGGGAACGGAAGTCCGAAAAT
TCGAAAACCAAACACACCGAAATTAGAGTTTCGGCCAAAGAATCGAGTCC
GGGTGCTCCGCTACGCATTCACCGTGTGTTCCTTAAAATATATTTTCAAA
GTCGATCGAAGTGTTAGCAGCACGTGTATTATCTTAATTTTTTTTTACGT
TCAGCAGCCATTTGTTTTCTATTTTATAAATACTATAATCCGAGATGGTC
AAAACTGCCACCTTTTGGCGTTGCCTTTTCTTTACATTATGTGGAAGCTT
TTTGACGGTTACTCAGGCCAAAGCAGCAACTAGCAACGCAAGCAGTTTTT
TGGAGGTGTCGCTGCGCTATTTTGATGAGCAGCTTCTGCTGGACATCCTG
CCACGCGCTCAGTGTCCTGGCGAGGATGAAGGATCTCCGATGGACGAGTT
CGCCGACCTGTTTACGGTGGATCAACTTCGCCAGGGATGGGTGGTGCTGC
ACGTCTTCGCTGCGGTTTACTTCTTTATCCTGCTGGCCATCATTTGCAAC
GACTACTTCCTGCCGACTGTGGAGTGCATCTGCGAGGACTTGCACCTTTC
GAAGGACGTGGCAGCGGCCACTTTCATGGCTACCGCCACCTCCATGCCCG
AATTCTTTACGAACACGATCAGCACGTTGATTCTGGAGTCAGATATGGGC
CTGGGCACGATTATCGGCTCGTTAATGTTCAACACATTGGGAGTGGCCGG
CCTAGCTGCGCTCGCCATCGATAAGCCGGTGCAACTGGACTGGTGGCCCA
TAGCTCGCGACTGCTTTATTTATGTCTTCAACACGATTATCCTGCTGGTC
TTGGCCTGGAGTGGAAGCATTAGTTTCACGGAGTCCTGCATCATGATGGG
ATTCCTCATCCTTTACTACCTTATCACGTTTAACAACAACAAGTTTATGC
CCGCCATCCGGGTGTTTATCGAGGATCGTATGAACTGCTGCTTCTCCACG
CGATATGATCTAACGGAGCCTCCAGAGAACAGTGCCAAGGCGCAGCTTCC
ACTCAAAAAAGATCCTCTGTCCGGCGATGGCCTCTTTGTTCTTAATCTTC
CCGAAAACACCTCGTCCATGTCTTCCACCGCCAACCTCACACGTAACAAG
CATCTTAACGACGAGGACGACGTCGCAGACGTAGTGCCCGGGAGCATATA
CGCTTACCCGCGTGACGCATCCGGTTGGATGCAATTCTGGTGGATCTTCG
TCTTCCCCATTAAGGTCACGCTATCCCTATTGATCCCGCACCCGATGAAG
TACCGCCGACTGTACCCATTATCTTTTATCATGTGCATCTTGTGCATTGG
CGGAAACGCCTACCTTATTGTCTGGATGCTGACTGCCTTTGGTGTGGCCA
TTCATGTGCCTACCATTGTGATGGGTCTGACCTTCTTGGCTGCTGGCTCT
ACCATGCCGGAAGCCGTCTCCAGTCTTATTTCCCTTAGAAATGGGGAAAA
TGGCATTGGAGTTTCTAATTCGTTGGGCGCTAACTCCTTGGCCATCTTGC
TATCCCTTGGAGTGCCTTGGTTCATCAAGAATTGTATACACTACGGAACT
GGGGAGCCCCAGCAGGTTGGCACCCAGGGCATCGAGTATAACATCCTGAT
CTTGATCATATCCACTATGGCGCTGTTCATAATCCTCAGCTTCAGTGGAT
ATCGGCTTACGAAGCGAGTGGGCGTAGCCCTCTTCACGGTGTACGGAGTC
TTTATTGTTCTACAGATCCTCATCGAGATGAATGTATTCTTTCCCAGAGA
TTGCAGCAGCTAGTGATGGACAAAGATTTGTTGTAAAAAAATCACCCTTG
CACAAATCTTTTGGTGCCGGCACCAGGAGTTTATCACTATTACAAAGACA
CCCTATTTACAGGACCTACATTTTGTGTAATTATATTTAGGAAATACTAT
ACCATCTAAAAAAGTTTGAATGTTTTAAATGATAAGTACAACAATTTTAT
GTCTTGGCTGTACTTTGTAATTATCATTTTAATACTCAACCAGGAATCAG
AGGCAGTACACATCCTGTATTTCTAACCCTACTTTACGATATAATTAATA
CGTAAGACTGTCTATAGATTTAGAAGACGAGGCTTCCATCAGCTATTTCT
ATTTATTTCGTGAGTGTATCTTAAGGCCCGTAGTACAACCAACAAATGTT
TAAACCGTTACCAAAGCACAAAACGAGATACTAGCAGTTAAGAAAATATT
ACACGCTTATCCGGAAGAGTCCATGATATTCACCCATTCTGCCCAGGCCT
GTCGCTGACAGAAGAAATTCGTAACATCATAAAAACGTTCTGTTGATATT
CCGCGTATATACTTAGCGCTTTAGCAACTACTTGTTAACTCTGCCTAATA
TACTTGATACCATTATTATTAATTTATAAATATACCTTAAGACAATTCTT
ACCGAATCATTATATTATTATTAAATTGTCTTTCAAACTGATCCCGAGAC
TATCTAGGGGCCAATTCATTAGACTTTGAAGCCAGTTTAAAAATAAAACA
GTGATAATTGGGTGGCGGTTTGTCGTTAGGTTTTTAGTTTCATTTAGGGG
AATAATTGAAATTACCTTGAAGTTGTTACATCACAAATAATATCATTGAA
TGAGATCAAATACACCTTAATACACATCCAGTATGCAAAATTCGTAGAAC
GATACCCAAAGTTAATTAATTGGAGTGTATCTAGGCGTGTACACTATTTA
TCTTAAAGATATATAAGTACATTTGTAAATATATAAGGAGAAACTTTATT
TCCCCATTACCACTAAATATAAATAAGTTCAATAAAAAAAAAAAAAAA

RE48874.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
chrXHet 204175 chrXHet 58680..60019 1543..2883 6595 99.6 Plus
chrXHet 204175 chrXHet 47172..47545 1..373 1820 99.7 Plus
chrXHet 204175 chrXHet 57645..57984 1205..1544 1700 100 Plus
chrXHet 204175 chrXHet 53635..53943 517..825 1530 99.7 Plus
chrXHet 204175 chrXHet 56729..56962 824..1057 1155 99.6 Plus
chrXHet 204175 chrXHet 57033..57184 1057..1208 745 99.3 Plus
chr2L 23010047 chr2L 21729995..21730169 2611..2786 740 96 Plus
chrXHet 204175 chrXHet 51975..52120 372..517 730 100 Plus
chr2L 23010047 chr2L 21730228..21730308 2803..2883 315 92.6 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-RD 1569 CG17167-PD 1..1569 295..1863 7845 100 Plus
CG17167-RC 1566 CG17167-PC 1..1566 295..1863 7765 99.8 Plus
CG17167-RF 1503 CG17167-PF 14..1503 374..1863 7450 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-RF 2597 CG17167-RF 89..2597 374..2883 12500 100 Plus
CG17167-RD 2506 CG17167-RD 3..2506 1..2504 12425 99.9 Plus
CG17167-RC 2503 CG17167-RC 3..2503 1..2504 12345 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-PD 522 CG17167-PD 1..522 295..1860 2662 100 Plus
CG17167-PC 521 CG17167-PC 1..521 295..1860 2646 99.8 Plus
CG17167-PF 500 CG17167-PF 2..500 364..1860 2521 99.4 Plus
CG17167-PE 409 CG17167-PE 1..303 295..1203 1525 100 Plus
zyd-PG 499 CG2893-PG 11..489 490..1842 729 35.4 Plus
CG17167-PE 409 CG17167-PE 285..409 1504..1860 541 88.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 23079805..23081147 1543..2886 6670 99.9 Plus
X 23542271 X 23068303..23068676 1..373 1820 99.7 Plus
X 23542271 X 23078770..23079109 1205..1544 1700 100 Plus
X 23542271 X 23074762..23075070 517..825 1545 100 Plus
X 23542271 X 23077856..23078089 824..1057 1170 100 Plus
X 23542271 X 23078159..23078310 1057..1208 745 99.3 Plus
2L 23513712 2L 21731480..21731654 2611..2786 740 96 Plus
X 23542271 X 23073102..23073247 372..517 730 100 Plus
2L 23513712 2L 21731708..21731795 2799..2886 335 92 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 23064897..23066239 1543..2886 6680 99.9 Plus
X 23527363 X 23053395..23053768 1..373 1830 99.7 Plus
X 23527363 X 23063862..23064201 1205..1544 1700 100 Plus
X 23527363 X 23059854..23060162 517..825 1545 100 Plus
X 23527363 X 23062948..23063181 824..1057 1170 100 Plus
2L 23513712 2L 21731480..21731654 2611..2786 750 96 Plus
X 23527363 X 23063251..23063402 1057..1208 745 99.3 Plus
X 23527363 X 23058194..23058339 372..517 730 100 Plus
2L 23513712 2L 21731708..21731795 2799..2886 335 92 Plus
Blast to na_te.dros performed 2014-11-27 16:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 2054..2156 2014..2115 125 59.2 Plus

RE48874.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:59:06 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
chrXHet 58681..60019 1544..2883 99   Plus
chrXHet 57645..57983 1205..1543 100 -> Plus
chrXHet 57034..57180 1058..1204 100 -> Plus
chrXHet 56731..56962 826..1057 99 -> Plus
chrXHet 53636..53943 518..825 99 -> Plus
chrXHet 51977..52120 374..517 100 -> Plus
chrXHet 47172..47545 1..373 99 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-11 10:26:09 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RD 1..1569 295..1863 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:39:58 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RD 1..1569 295..1863 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:59:06 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RD 1..1569 295..1863 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-11 10:26:09 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RD 1..2504 1..2504 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:39:58 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RF 89..2597 374..2883 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:59:06 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
CG17167-RF 89..2597 374..2883 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:59:06 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
X 23079806..23081144 1544..2883 99   Plus
X 23078770..23079108 1205..1543 100 -> Plus
X 23078160..23078306 1058..1204 100 -> Plus
X 23077858..23078089 826..1057 100 -> Plus
X 23074763..23075070 518..825 100 -> Plus
X 23073104..23073247 374..517 100 -> Plus
X 23068303..23068676 1..373 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:39:58 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
XHet 58624..59962 1544..2883 99   Plus
XHet 57588..57926 1205..1543 100 -> Plus
XHet 56978..57124 1058..1204 100 -> Plus
XHet 56676..56907 826..1057 100 -> Plus
XHet 53581..53888 518..825 100 -> Plus
XHet 51922..52065 374..517 100 -> Plus
XHet 47121..47494 1..373 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:54:43 Download gff for RE48874.complete
Subject Subject Range Query Range Percent Splice Strand
X 23064898..23066236 1544..2883 99   Plus
X 23063862..23064200 1205..1543 100 -> Plus
X 23063252..23063398 1058..1204 100 -> Plus
X 23062950..23063181 826..1057 100 -> Plus
X 23059855..23060162 518..825 100 -> Plus
X 23058196..23058339 374..517 100 -> Plus
X 23053395..23053768 1..373 99 -> Plus

RE48874.pep Sequence

Translation from 294 to 1862

> RE48874.pep
MVKTATFWRCLFFTLCGSFLTVTQAKAATSNASSFLEVSLRYFDEQLLLD
ILPRAQCPGEDEGSPMDEFADLFTVDQLRQGWVVLHVFAAVYFFILLAII
CNDYFLPTVECICEDLHLSKDVAAATFMATATSMPEFFTNTISTLILESD
MGLGTIIGSLMFNTLGVAGLAALAIDKPVQLDWWPIARDCFIYVFNTIIL
LVLAWSGSISFTESCIMMGFLILYYLITFNNNKFMPAIRVFIEDRMNCCF
STRYDLTEPPENSAKAQLPLKKDPLSGDGLFVLNLPENTSSMSSTANLTR
NKHLNDEDDVADVVPGSIYAYPRDASGWMQFWWIFVFPIKVTLSLLIPHP
MKYRRLYPLSFIMCILCIGGNAYLIVWMLTAFGVAIHVPTIVMGLTFLAA
GSTMPEAVSSLISLRNGENGIGVSNSLGANSLAILLSLGVPWFIKNCIHY
GTGEPQQVGTQGIEYNILILIISTMALFIILSFSGYRLTKRVGVALFTVY
GVFIVLQILIEMNVFFPRDCSS*

RE48874.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22024-PA 495 GF22024-PA 3..495 29..522 2347 91.9 Plus
Dana\GF22023-PA 410 GF22023-PA 16..347 90..474 490 31.6 Plus
Dana\GF22022-PA 540 GF22022-PA 327..530 317..516 400 40.8 Plus
Dana\GF22022-PA 540 GF22022-PA 20..222 66..261 386 37.9 Plus
Dana\GF21888-PA 852 GF21888-PA 316..472 71..229 323 40.9 Plus
Dana\GF18207-PA 637 GF18207-PA 442..635 333..522 321 36.9 Plus
Dana\GF21888-PA 852 GF21888-PA 621..847 283..514 263 29.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19761-PA 546 GG19761-PA 197..440 11..254 1136 91.4 Plus
Dere\GG19761-PA 546 GG19761-PA 437..546 413..522 548 97.3 Plus
Dere\GG19760-PA 513 GG19760-PA 300..503 317..516 399 40.8 Plus
Dere\GG19760-PA 513 GG19760-PA 20..201 66..246 388 40.7 Plus
Dere\GG24012-PA 865 GG24012-PA 330..483 71..224 322 40.9 Plus
Dere\GG12329-PA 646 GG12329-PA 453..646 333..522 321 36.9 Plus
Dere\GG12329-PA 646 GG12329-PA 122..261 79..218 300 40 Plus
Dere\GG24012-PA 865 GG24012-PA 634..860 283..514 261 29.2 Plus
Dere\GG19761-PA 546 GG19761-PA 4..141 103..241 219 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12048-PA 603 GH12048-PA 437..573 30..166 572 85.4 Plus
Dgri\GH12048-PA 603 GH12048-PA 20..222 66..261 386 38.4 Plus
Dgri\GH18869-PA 650 GH18869-PA 445..638 333..522 328 37.4 Plus
Dgri\GH25072-PA 856 GH25072-PA 322..475 71..224 324 40.9 Plus
Dgri\GH18869-PA 650 GH18869-PA 106..245 79..218 297 38.6 Plus
Dgri\GH25072-PA 856 GH25072-PA 624..851 283..514 254 29.5 Plus
Dgri\GH12048-PA 603 GH12048-PA 334..438 317..419 238 42.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-PD 522 CG17167-PD 1..522 1..522 2718 100 Plus
CG17167-PC 521 CG17167-PC 1..521 1..522 2702 99.8 Plus
CG17167-PF 500 CG17167-PF 2..500 24..522 2577 99.4 Plus
CG17167-PE 409 CG17167-PE 1..303 1..303 1581 100 Plus
zyd-PG 499 CG2893-PG 11..489 66..516 776 35.4 Plus
CG17167-PE 409 CG17167-PE 285..409 404..522 541 88.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16301-PA 340 GI16301-PA 102..337 104..315 759 62.3 Plus
Dmoj\GI18208-PA 838 GI18208-PA 304..457 71..224 323 40.9 Plus
Dmoj\GI24726-PA 629 GI24726-PA 398..627 296..522 320 33.2 Plus
Dmoj\GI24726-PA 629 GI24726-PA 104..243 79..218 299 40 Plus
Dmoj\GI18208-PA 838 GI18208-PA 606..832 283..513 250 29.2 Plus
Dmoj\GI16301-PA 340 GI16301-PA 1..112 128..239 199 34.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18331-PA 895 GL18331-PA 20..175 22..177 683 89.1 Plus
Dper\GL18328-PA 237 GL18328-PA 24..227 317..516 397 40.8 Plus
Dper\GL18327-PA 269 GL18327-PA 42..212 66..235 373 42.1 Plus
Dper\GL19214-PA 823 GL19214-PA 338..494 71..229 323 40.9 Plus
Dper\GL12321-PA 650 GL12321-PA 455..648 333..522 316 35.9 Plus
Dper\GL19214-PA 823 GL19214-PA 642..779 283..422 158 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27534-PA 256 GA27534-PA 21..252 23..254 1086 91.4 Plus
Dpse\GA27529-PA 172 GA27529-PA 1..172 351..522 858 95.9 Plus
Dpse\GA27524-PA 465 GA27524-PA 76..443 90..513 500 29.9 Plus
Dpse\GA27521-PA 536 GA27521-PA 323..526 317..516 402 40.8 Plus
Dpse\GA27521-PA 536 GA27521-PA 20..228 66..261 366 37.1 Plus
Dpse\GA15039-PA 871 GA15039-PA 337..493 71..229 323 40.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13278-PA 522 GM13278-PA 1..522 1..522 2628 96.9 Plus
Dsec\GM13276-PA 399 GM13276-PA 3..381 79..512 492 28.7 Plus
Dsec\GM13275-PA 339 GM13275-PA 20..158 66..203 357 48.9 Plus
Dsec\GM10748-PA 642 GM10748-PA 449..642 333..522 322 36.9 Plus
Dsec\GM12319-PA 857 GM12319-PA 322..475 71..224 322 40.9 Plus
Dsec\GM10748-PA 642 GM10748-PA 98..337 58..319 311 29.8 Plus
Dsec\GM13275-PA 339 GM13275-PA 138..329 332..516 280 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15468-PA 744 GD15468-PA 247..744 25..522 2508 97 Plus
Dsim\GD22341-PA 529 GD22341-PA 34..524 71..514 508 29.2 Plus
Dsim\GD15467-PA 499 GD15467-PA 286..489 317..516 391 40.3 Plus
Dsim\GD15467-PA 499 GD15467-PA 11..192 66..246 389 40.7 Plus
Dsim\GD19720-PA 642 GD19720-PA 449..642 333..522 322 36.9 Plus
Dsim\GD19720-PA 642 GD19720-PA 98..337 58..319 305 29.4 Plus
Dsim\GD15468-PA 744 GD15468-PA 13..245 114..412 279 28.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16690-PA 259 GJ16690-PA 35..259 298..522 944 79.6 Plus
Dvir\GJ16689-PA 560 GJ16689-PA 347..550 317..516 394 39.8 Plus
Dvir\GJ16689-PA 560 GJ16689-PA 20..222 66..261 386 38.4 Plus
Dvir\GJ14553-PA 629 GJ14553-PA 434..627 333..522 326 36.9 Plus
Dvir\GJ14796-PA 822 GJ14796-PA 288..441 71..224 323 40.9 Plus
Dvir\GJ14553-PA 629 GJ14553-PA 79..248 58..224 316 37.6 Plus
Dvir\GJ14796-PA 822 GJ14796-PA 590..817 283..514 256 29.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25593-PA 722 GK25593-PA 324..722 75..522 1809 81.5 Plus
Dwil\GK19909-PA 528 GK19909-PA 20..518 66..516 737 34.7 Plus
Dwil\GK24823-PA 893 GK24823-PA 359..512 71..224 325 40.9 Plus
Dwil\GK13526-PA 635 GK13526-PA 441..632 333..520 314 36.8 Plus
Dwil\GK13526-PA 635 GK13526-PA 107..246 79..218 305 40.7 Plus
Dwil\GK24823-PA 893 GK24823-PA 662..888 283..514 256 28.8 Plus
Dwil\GK25593-PA 722 GK25593-PA 193..326 290..419 160 30.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15239-PA 522 GE15239-PA 1..522 1..522 2572 95.4 Plus
Dyak\GE17955-PA 243 GE17955-PA 30..233 317..516 399 40.8 Plus
Dyak\GE17953-PA 196 GE17953-PA 20..194 66..239 372 41.1 Plus
Dyak\GE25410-PA 628 GE25410-PA 434..628 331..522 322 37.1 Plus
Dyak\GE10380-PA 870 GE10380-PA 335..488 71..224 322 40.9 Plus
Dyak\GE25410-PA 628 GE25410-PA 84..314 58..308 307 29.9 Plus

RE48874.hyp Sequence

Translation from 294 to 1862

> RE48874.hyp
MVKTATFWRCLFFTLCGSFLTVTQAKAATSNASSFLEVSLRYFDEQLLLD
ILPRAQCPGEDEGSPMDEFADLFTVDQLRQGWVVLHVFAAVYFFILLAII
CNDYFLPTVECICEDLHLSKDVAAATFMATATSMPEFFTNTISTLILESD
MGLGTIIGSLMFNTLGVAGLAALAIDKPVQLDWWPIARDCFIYVFNTIIL
LVLAWSGSISFTESCIMMGFLILYYLITFNNNKFMPAIRVFIEDRMNCCF
STRYDLTEPPENSAKAQLPLKKDPLSGDGLFVLNLPENTSSMSSTANLTR
NKHLNDEDDVADVVPGSIYAYPRDASGWMQFWWIFVFPIKVTLSLLIPHP
MKYRRLYPLSFIMCILCIGGNAYLIVWMLTAFGVAIHVPTIVMGLTFLAA
GSTMPEAVSSLISLRNGENGIGVSNSLGANSLAILLSLGVPWFIKNCIHY
GTGEPQQVGTQGIEYNILILIISTMALFIILSFSGYRLTKRVGVALFTVY
GVFIVLQILIEMNVFFPRDCSS*

RE48874.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17167-PD 522 CG17167-PD 1..522 1..522 2718 100 Plus
CG17167-PC 521 CG17167-PC 1..521 1..522 2702 99.8 Plus
CG17167-PF 500 CG17167-PF 2..500 24..522 2577 99.4 Plus
CG17167-PE 409 CG17167-PE 1..303 1..303 1581 100 Plus
zyd-PG 499 CG2893-PG 11..489 66..516 776 35.4 Plus
CG17167-PE 409 CG17167-PE 285..409 404..522 541 88.8 Plus