Clone RE50082 Report

Search the DGRC for RE50082

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:500
Well:82
Vector:pFlc-1
Associated Gene/TranscriptCrc-RA
Protein status:RE50082.pep: gold
Sequenced Size:1438

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9429 2002-10-19 Blastp of sequenced clone
CG9429 2003-01-01 Sim4 clustering to Release 3
Crc 2008-04-29 Release 5.5 accounting
Crc 2008-08-15 Release 5.9 accounting
Crc 2008-12-18 5.12 accounting

Clone Sequence Records

RE50082.complete Sequence

1438 bp (1438 high quality bases) assembled on 2002-10-19

GenBank Submission: BT001670

> RE50082.complete
GGTACTTAACTTTAACCGAGTTCGGACAACCATCGGAGTTGGAAGAGTCA
GTCCAAAAAGTGGTGCGGGATCGTTCACATGATGTGGTGCAAAACAGTGA
TAGTGTTGCTGGCGACAGTCGGCTTTATTAGTGCCGAGGTTTATCTGAAG
GAGAATTTCGACAACGAAAACTGGGAGGATACGTGGATCTACAGCAAACA
TCCTGGCAAGGAGTTCGGAAAATTCGTCCTCACCCCCGGTACCTTCTACA
ACGATGCTGAGGCCGACAAAGGCATTCAGACCTCTCAGGATGCTCGATTC
TACGCGGCCAGCCGCAAGTTTGATGGCTTCTCCAACGAGGACAAGCCCCT
CGTGGTGCAGTTCTCCGTGAAGCACGAGCAGAATATCGACTGCGGCGGCG
GCTATGTGAAGCTGTTCGACTGCTCCCTCGACCAGACCGACATGCACGGC
GAGTCGCCGTACGAGATCATGTTCGGCCCGGACATCTGCGGACCCGGCAC
CAAGAAGGTCCATGTGATCTTCAGCTACAAGGGCAAGAACCACCTAATCA
GCAAAGACATCCGCTGCAAAGATGACGTGTACACCCACTTCTACACGCTG
ATTGTCAGACCCGACAACACGTACGAGGTGCTCATCGACAACGAGAAGGT
GGAGTCTGGCAACCTGGAGGACGACTGGGACTTCCTGGCCCCCAAGAAGA
TCAAGGATCCCACCGCCACCAAGCCCGAAGACTGGGACGATAGGGCCACC
ATTCCCGATCCCGATGACAAGAAGCCCGAGGACTGGGACAAACCAGAGCA
CATTCCCGACCCAGATGCCACAAAGCCTGAGGATTGGGACGATGAGATGG
ACGGCGAGTGGGAGCCACCGATGATCGACAACCCTGAGTTCAAGGGCGAG
TGGCAGCCAAAGCAGCTGGACAACCCCAACTACAAGGGCGCCTGGGAGCA
TCCCGAGATCGCCAATCCCGAGTATGTGCCCGACGACAAGCTGTATCTGC
GCAAGGAGATCTGCACCCTGGGCTTCGATCTCTGGCAGGTCAAGTCCGGC
ACTATCTTCGACAACGTCCTGATCACGGACGACGTGGAGCTGGCCGCTAA
GGCTGCTGCCGAAGTCAAGAACACCCAGGCGGGCGAGAAGAAAATGAAGG
AGGCCCAGGATGAGGTGCAGCGCAAGAAGGACGAGGAGGAGGCGAAAAAG
GCTTCCGACAAGGACGATGAGGACGAGGATGATGACGATGAGGAGAAGGA
TGATGAATCTAAGCAAGACAAAGATCAAAGCGAACACGACGAATTGTAAG
GACGTCTAGGGAAAATTACGTCGAGAAATATTCGGTATTTTTTGTGTGTT
GGTAGCTGCTTTGATGTTCTAAGCAACGGAAACCACAATTACAATTTGTA
AGACTTATAATTTATAAACATAAAAAAAAAAAAAAAAA

RE50082.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-RA 1960 Crc-RA 254..1675 2..1422 7070 99.9 Plus
Crc.e 2012 Crc.e 133..1554 2..1422 7070 99.9 Plus
Crc.b 1884 Crc.b 254..1406 2..1154 5765 100 Plus
Crc.b 1884 Crc.b 1400..1636 1187..1422 1145 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5454752..5455430 1421..744 3345 99.9 Minus
chr3R 27901430 chr3R 5455521..5455996 745..270 2365 99.8 Minus
chr3R 27901430 chr3R 5456492..5456656 166..2 825 100 Minus
chr3R 27901430 chr3R 5456262..5456368 272..166 535 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-RB 1221 CG9429-PB 1..1221 79..1299 6105 100 Plus
Crc-RA 1221 CG9429-PA 1..1221 79..1299 6105 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-RB 1677 CG9429-RB 10..1430 2..1421 7055 99.9 Plus
Crc-RA 1430 CG9429-RA 10..1430 2..1421 7055 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-PB 406 CG9429-PB 1..365 79..1173 1715 100 Plus
Crc-PA 406 CG9429-PA 1..365 79..1173 1715 100 Plus
CG1924-PA 570 CG1924-PA 145..426 340..1077 368 35.7 Plus
Cnx99A-PE 604 CG11958-PE 149..448 340..1077 348 35.6 Plus
Cnx99A-PD 605 CG11958-PD 149..448 340..1077 348 35.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9628937..9629616 1422..744 3350 99.9 Minus
3R 32079331 3R 9629707..9630182 745..270 2380 100 Minus
3R 32079331 3R 9630678..9630842 166..2 825 100 Minus
3R 32079331 3R 9630448..9630554 272..166 535 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9369768..9370447 1422..744 3360 99.8 Minus
3R 31820162 3R 9370538..9371013 745..270 2380 100 Minus
3R 31820162 3R 9371509..9371673 166..2 825 100 Minus
3R 31820162 3R 9371279..9371385 272..166 535 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:01:45 has no hits.

RE50082.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:36:45 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5456492..5456656 1..166 99   Minus
chr3R 5456263..5456367 167..271 100 <- Minus
chr3R 5455522..5455994 272..744 99 <- Minus
chr3R 5455048..5455429 745..1126 100 <- Minus
chr3R 5454752..5454917 1257..1421 99 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:20:38 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 1..1221 79..1299 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:09:24 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 1..1221 79..1299 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:53:48 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 1..1221 79..1299 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:00:18 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 1..1221 79..1299 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:36:45 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 1..1221 79..1299 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:30:14 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 43..1464 1..1421 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:09:24 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 43..1464 1..1421 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:53:48 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 9..1430 1..1421 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:00:19 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 43..1464 1..1421 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:36:45 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 9..1430 1..1421 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:36:45 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9630678..9630842 1..166 99   Minus
3R 9630449..9630553 167..271 100 <- Minus
3R 9629708..9630180 272..744 100 <- Minus
3R 9628938..9629615 745..1421 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:53:48 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5456400..5456564 1..166 99   Minus
arm_3R 5456171..5456275 167..271 100 <- Minus
arm_3R 5455430..5455902 272..744 100 <- Minus
arm_3R 5454660..5455337 745..1421 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:49 Download gff for RE50082.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9371509..9371673 1..166 99   Minus
3R 9371280..9371384 167..271 100 <- Minus
3R 9370539..9371011 272..744 100 <- Minus
3R 9369769..9370446 745..1421 99 <- Minus

RE50082.pep Sequence

Translation from 78 to 1298

> RE50082.pep
MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFV
LTPGTFYNDAEADKGIQTSQDARFYAASRKFDGFSNEDKPLVVQFSVKHE
QNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSY
KGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDW
DFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKP
EDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYV
PDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQ
AGEKKMKEAQDEVQRKKDEEEAKKASDKDDEDEDDDDEEKDDESKQDKDQ
SEHDEL*

RE50082.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 01:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18838-PA 404 GF18838-PA 1..404 2..406 1925 91.6 Plus
Dana\GF22893-PA 652 GF22893-PA 123..460 63..344 506 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 01:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17350-PA 406 GG17350-PA 1..406 1..406 2126 99.5 Plus
Dere\GG12019-PA 651 GG12019-PA 151..461 88..344 519 37.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 01:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19579-PA 403 GH19579-PA 1..403 2..406 1743 81.5 Plus
Dgri\GH14000-PA 598 GH14000-PA 114..451 63..344 528 36.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-PB 406 CG9429-PB 1..406 1..406 2237 100 Plus
Crc-PA 406 CG9429-PA 1..406 1..406 2237 100 Plus
Cnx99A-PE 604 CG11958-PE 149..551 88..397 570 32.7 Plus
CG1924-PA 570 CG1924-PA 145..437 88..344 564 39.1 Plus
Cnx99A-PD 605 CG11958-PD 149..552 88..397 560 32.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 01:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23963-PA 397 GI23963-PA 5..397 7..406 1653 79 Plus
Dmoj\GI22345-PA 614 GI22345-PA 125..462 63..344 541 37.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 01:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21957-PA 405 GL21957-PA 1..405 1..406 1828 86.9 Plus
Dper\GL13597-PA 649 GL13597-PA 118..455 63..344 523 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 01:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27323-PB 382 GA27323-PB 1..382 1..406 1668 81.3 Plus
Dpse\GA26840-PA 607 GA26840-PA 118..455 63..344 525 37.1 Plus
Dpse\GA26840-PB 649 GA26840-PB 118..455 63..344 523 37.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 01:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26236-PA 406 GM26236-PA 1..406 1..406 2126 99.5 Plus
Dsec\GM13150-PA 557 GM13150-PA 135..423 89..344 501 39.6 Plus
Dsec\GM13395-PA 645 GM13395-PA 135..444 89..344 491 35.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 01:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20777-PA 406 GD20777-PA 1..406 1..406 2127 99.8 Plus
Dsim\GD17820-PA 648 GD17820-PA 149..459 88..344 522 37.8 Plus
Dsim\GD15935-PA 551 GD15935-PA 134..417 88..344 476 38.9 Plus
Dsim\GD15746-PA 355 GD15746-PA 2..129 233..344 237 38.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 01:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22515-PA 403 GJ22515-PA 2..403 4..406 1777 83.6 Plus
Dvir\GJ14222-PA 662 GJ14222-PA 125..462 63..344 529 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 01:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13913-PA 403 GK13913-PA 5..403 7..406 1796 87 Plus
Dwil\GK11031-PA 646 GK11031-PA 117..454 63..344 515 35.8 Plus
Dwil\GK17146-PA 583 GK17146-PA 95..435 63..346 434 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 01:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24756-PA 406 GE24756-PA 1..406 1..406 2121 99.3 Plus
Dyak\GE10455-PA 651 GE10455-PA 151..461 88..344 519 37.5 Plus

RE50082.hyp Sequence

Translation from 78 to 1298

> RE50082.hyp
MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFV
LTPGTFYNDAEADKGIQTSQDARFYAASRKFDGFSNEDKPLVVQFSVKHE
QNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSY
KGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDW
DFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKP
EDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYV
PDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQ
AGEKKMKEAQDEVQRKKDEEEAKKASDKDDEDEDDDDEEKDDESKQDKDQ
SEHDEL*

RE50082.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-PB 406 CG9429-PB 1..406 1..406 2237 100 Plus
Crc-PA 406 CG9429-PA 1..406 1..406 2237 100 Plus
Cnx99A-PE 604 CG11958-PE 149..551 88..397 570 32.7 Plus
CG1924-PA 570 CG1924-PA 145..437 88..344 564 39.1 Plus
Cnx99A-PD 605 CG11958-PD 149..552 88..397 560 32.8 Plus