Clone RE51713 Report

Search the DGRC for RE51713

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:517
Well:13
Vector:pFlc-1
Associated Gene/TranscriptMED27-RA
Protein status:RE51713.pep: gold
Preliminary Size:927
Sequenced Size:1089

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1245 2002-01-01 Sim4 clustering to Release 2
CG1245 2003-01-01 Sim4 clustering to Release 3
CG1245 2003-01-22 Blastp of sequenced clone
MED27 2008-04-29 Release 5.5 accounting
MED27 2008-08-15 Release 5.9 accounting
MED27 2008-12-18 5.12 accounting

Clone Sequence Records

RE51713.complete Sequence

1089 bp (1089 high quality bases) assembled on 2003-01-22

GenBank Submission: AY075500

> RE51713.complete
ATTGGCATTCGCAAAGAAAACAAAGTAAACATTTTTTTTTGCCGGAACGA
GAATTACCGTTATGGATAAGTTAAATTCCACTCTAACTGCCGTCAAAAAC
CTGCGGTCCAACGTAAGGCTGTGCTTCGAGCACCTGGCCGATGGAACCGA
TGGGGAGAGCGGCGAGGAGAGCCGGAATAAGTTCGTAAATGACTTCCAGG
AGAGATTCGCAGCCATCAACTCGCAAATACGTGAGGTAGAGCAGCTGATT
AATGGACTGCCGGTGCCACCAACACCCTATTCTCTCGGGAACACCGCCTA
CCTGGCGCAGGAAACTTCGCAGGATCGACAGGCTCTATACCCTCAGCTGG
TGAACAGCTACAAGTGGATGGACAAGGTGCACGACCACAGCTTCTTGGCC
TTCAACAATCTCAACCAGAACACACTCAGGCGCTCCTACAATTACTGCTC
GCAGAAGCGCCAGCGACTGCCCTTCTCGTCCTTCAACAACGATCCAGACC
ACATAGATAAGCTCCTGAGTGAGATCAACACCCCTCCGCATACTTCGTAC
AGAATTTTTCGTCCCTTCGGCACAAACGCTGTCACCATCGTAACAATAAG
TAACGTGATGAAGGCGGCTATTGTCTTCAAAGGAGTGCTTATAGAGTGGG
TTACGGTTAAGGGATTCGATGAGCCGCTGGAGCATGACGACCTGTGGGCC
GAGTCACGTTACGAGGTGTTCCGCAAAGTCCAGGATCATGCTCACTCAGC
AATGCTGCATTTCTTTTCGCCGACGTTGCCCGATCTGGCAGTGAAAAGCT
ATATAACCTGGCTGAACAGCCACGTCAAACTTTTCCTGGAGCCCTGCAAG
CGTTGTGGGAAATTCGTGGTGAACGGATTGCCTCCGACGTGGCGGGACCT
GCGCACTCTAGAACCCTTCCACGAGGACTGCCGAAATTGCTAAGGATTTT
TAAGTAATTTAACGCCGATAGTTGTAACTTGTATACTTCATTTATTTCAA
AAACAAAAATTATATGTACTTTGAATGCATGCGGGCGGATTTTTTAAAAT
CGCTGCGCCCGACTGAATAACTACAAAAAAAAAAAAAAA

RE51713.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-RA 1219 MED27-RA 144..1219 1..1076 5380 100 Plus
CG2182-RB 2074 CG2182-RB 1966..2074 1076..968 545 100 Minus
CG2182.d 2112 CG2182.d 2004..2112 1076..968 545 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1481419..1481994 499..1074 2880 100 Plus
chr3R 27901430 chr3R 1481091..1481358 231..498 1340 100 Plus
chr3R 27901430 chr3R 1480803..1481033 1..231 1155 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-RA 882 CG1245-PA 1..882 62..943 4410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:00:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-RA 1080 CG1245-RA 7..1080 1..1074 5370 100 Plus
CG2182-RA 2415 CG2182-RA 2315..2415 1074..974 505 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-PA 293 CG1245-PA 1..293 62..940 1575 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5655761..5656338 499..1076 2890 100 Plus
3R 32079331 3R 5655433..5655700 231..498 1340 100 Plus
3R 32079331 3R 5655145..5655375 1..231 1155 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5396592..5397169 499..1076 2890 100 Plus
3R 31820162 3R 5396264..5396531 231..498 1340 100 Plus
3R 31820162 3R 5395976..5396206 1..231 1155 100 Plus
Blast to na_te.dros performed on 2014-11-27 02:56:37 has no hits.

RE51713.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:03:56 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1481419..1481994 499..1074 100   Plus
chr3R 1481092..1481358 232..498 100 -> Plus
chr3R 1480803..1481033 1..231 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:12 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..882 62..943 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:53:41 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..882 62..943 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:18:42 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..882 62..943 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:44:45 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..882 62..943 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:03:56 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..882 62..943 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:08:13 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..1074 1..1074 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:53:41 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..1074 1..1074 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:18:42 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 7..1080 1..1074 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:44:46 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..1074 1..1074 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:03:56 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 7..1080 1..1074 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:03:56 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5655761..5656336 499..1074 100   Plus
3R 5655434..5655700 232..498 100 -> Plus
3R 5655145..5655375 1..231 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:18:42 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1481483..1482058 499..1074 100   Plus
arm_3R 1481156..1481422 232..498 100 -> Plus
arm_3R 1480867..1481097 1..231 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:15:40 Download gff for RE51713.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5396592..5397167 499..1074 100   Plus
3R 5396265..5396531 232..498 100 -> Plus
3R 5395976..5396206 1..231 100 -> Plus

RE51713.pep Sequence

Translation from 61 to 942

> RE51713.pep
MDKLNSTLTAVKNLRSNVRLCFEHLADGTDGESGEESRNKFVNDFQERFA
AINSQIREVEQLINGLPVPPTPYSLGNTAYLAQETSQDRQALYPQLVNSY
KWMDKVHDHSFLAFNNLNQNTLRRSYNYCSQKRQRLPFSSFNNDPDHIDK
LLSEINTPPHTSYRIFRPFGTNAVTIVTISNVMKAAIVFKGVLIEWVTVK
GFDEPLEHDDLWAESRYEVFRKVQDHAHSAMLHFFSPTLPDLAVKSYITW
LNSHVKLFLEPCKRCGKFVVNGLPPTWRDLRTLEPFHEDCRNC*

RE51713.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 23:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17578-PA 293 GF17578-PA 1..293 1..293 1476 91.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 23:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12980-PA 293 GG12980-PA 1..293 1..293 1535 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 23:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18376-PA 293 GH18376-PA 1..292 1..292 1441 89.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-PA 293 CG1245-PA 1..293 1..293 1575 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 23:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23367-PA 293 GI23367-PA 1..292 1..292 1422 86.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 23:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24390-PA 293 GL24390-PA 1..293 1..293 1472 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 23:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26598-PA 293 GA26598-PA 1..293 1..293 1472 91.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 23:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10829-PA 293 GM10829-PA 1..293 1..293 1566 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 23:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19807-PA 293 GD19807-PA 1..293 1..293 1570 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 23:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10362-PA 293 GJ10362-PA 1..292 1..292 1442 89 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 23:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22404-PA 293 GK22404-PA 1..293 1..293 1441 88.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 23:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10152-PA 293 GE10152-PA 1..293 1..293 1532 95.6 Plus

RE51713.hyp Sequence

Translation from 61 to 942

> RE51713.hyp
MDKLNSTLTAVKNLRSNVRLCFEHLADGTDGESGEESRNKFVNDFQERFA
AINSQIREVEQLINGLPVPPTPYSLGNTAYLAQETSQDRQALYPQLVNSY
KWMDKVHDHSFLAFNNLNQNTLRRSYNYCSQKRQRLPFSSFNNDPDHIDK
LLSEINTPPHTSYRIFRPFGTNAVTIVTISNVMKAAIVFKGVLIEWVTVK
GFDEPLEHDDLWAESRYEVFRKVQDHAHSAMLHFFSPTLPDLAVKSYITW
LNSHVKLFLEPCKRCGKFVVNGLPPTWRDLRTLEPFHEDCRNC*

RE51713.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-PA 293 CG1245-PA 1..293 1..293 1575 100 Plus