Clone RE52048 Report

Search the DGRC for RE52048

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:520
Well:48
Vector:pFlc-1
Associated Gene/Transcripttap-RA
Protein status:RE52048.pep: gold
Preliminary Size:2161
Sequenced Size:2141

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7659 2002-01-01 Sim4 clustering to Release 2
CG7659 2002-05-18 Blastp of sequenced clone
CG7659 2003-01-01 Sim4 clustering to Release 3
tap 2008-04-29 Release 5.5 accounting
tap 2008-08-15 Release 5.9 accounting
tap 2008-12-18 5.12 accounting

Clone Sequence Records

RE52048.complete Sequence

2141 bp (2141 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119146

> RE52048.complete
TAGTTGGTGCGGGCACGCGAGACGCGAAGAAACAACTCTCTCAAAGCGGA
AATCGTAAATCGGAAATGTGCTAAAGGATATACACACCGTGATACAGATA
CGAGATCATGGCCGCCTGCTACAATGCCTATAGCGCTGGATCACAGTCCT
TCGAGTTCGACGAGGACGACGACGACGCCTCCTTCGACAGTGGCTACGAG
AAGAGTTTCGAGACGGAGGCCCAGTTGAGCTCACGACGCCGCTTGGACTT
TGGCACTCCGCCGACTCCGGCGATCCCGCAACCGTACTCCGGCGGCACCT
GGGACGCCGTACCGCTCAGCTCACCGCCGGCGGGCTTCGTGGGATTGCTC
GATACGAGCAGCAATCACAGCACTCGGAGCGGCAGGACACTGGTCGAACA
TCTGAACAGTCGGGCCACGAATGGCGTCTTCGATCCGCCATTGACCAGTA
CGCCGGTGAAGTCGCCAGAGGATCCCAATGCGCCGCGACCGAAACGCAAA
TATGCCGTCGGCAAGAACAGAGTAACTCGCTCGCGCAGTCCAACCCAAGT
GGTGAAGATCAAGCGTTTCCGCCGCATGAAGGCCAATGACCGGGAGCGGA
ATCGGATGCATAACTTGAATGATGCCCTGGAGAAACTACGCGTCACTCTG
CCCTCGCTTCCCGAGGAGACGAAGCTGACGAAGATCGAGATTCTGCGATT
TGCGCACAACTACATCTTTGCCCTGGAGCAGGTGCTGGAAAGCGGAGGTT
CAATCAACCTGGATCTGGAGAAGCTGCAGAACTTCACGCTGAGTGGTGAG
AGGATTACCAAGGAGCTCTTCGATGCTCTTTTCGTGAATCCACAGCCGTA
TCCCTTGTTCGGACGAATGTTCCCCTATGGACAGGGAATGGCGCCTCTTG
CACAGCACCAGACTGCTCCAGCATCGCACGCGGAGCAGCCGCCGGCGATG
GGTGGCTTTCAGCACGGCATGGACTATCCGCAGCAGCCACCAGGATTCGA
CTTTACAGGCAGCATGCGGTTTTACCACCAACAGCAACAGCAGCCGCATC
AGCCTCACCATCTGCAGCCTAATCCCCAGCAGGAGTCCAGCCCGCAGCAG
TTCTCGCAGGAGAAATACGATCTGTTCAGGGGATCCTTCGATGCAGCTGC
CAATCTTCATTCTACGAACTTGGATTCTGGGATTCACCAGCAGAGCAGCT
TCTACTCGCAAACACCGCCATGGAAGGACTATCCGGAGGATCAGGCACAC
GTGCATCCCGTTCCACATCAACACAGCTACAAAAACTTCGCCCCGCAGGT
GTAGCACAGTTTTGTGGGCCAAACTACGATCTTAGGGTTTTCAGCGTGAT
ATACTAAAAGATTGCCGGAAATTGCAGGAAACTGATCAAGGGGAATTCCT
CTAAGCGATTTGCCCTTGACTTACTTTAAAAACATAACTAAAGTAACTTA
TGGGTCCTATCTCGGGATTTCCCTTCCTTACTTTTCTCAACTTTCCTGCA
ATCCGTTGATATTGGTAATAAGCGAGGCACCTAATTGACTGCTAAGATTA
TCATCAAGTTTGAAAATGAAATATCTTTAAAAATTGTATATTTCACACTT
GCGCTAATCTTTGAACTCAATTAGTTTCATGTTATAGAGGGATCCTCAAT
AGATTAACCAATTTAAAGTCAAACATCCAAAGTTAAGCTTCACGAACTCA
TTATTAATTCATATGAATTCCCATTATATTTGTATTCATTGGCTTCCTTC
TTGCGGATCTCTGGTGAATATTTGAATTAAAAGTGCTTAGGGTAATCAAT
TTTCCAAAAAGCACTCTTCTTCTCAACATATTCGCATTCTTCTTGACTAT
ATAGTACAAATCGGTTGTCCATTTAGTGTAAGCGATACGTACCTTGCCAT
TCTAGATTTAAGACCTATCTATAAGGATTCTTAAAATGAACCAGGTATTA
GCCATAATTAACTGTACAATCGATTAAGTGTATGTAGGTTATGCCAGATT
CTATATCAGTTATTGCAATGCAAGGAAAGCGAGCTAGTCAGGGCCAGAAC
TTTAAGGTGATAAGATTGAATTTCGATGTAAAACCATAAAGATTTATTTT
TGCAAATAAAGTTGACGATCAAAACGAAAAAAAAAAAAAAA

RE52048.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
tap-RA 2172 tap-RA 37..2163 1..2127 10635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17349137..17351262 1..2126 10615 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
tap-RA 1197 CG7659-PA 1..1197 108..1304 5985 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
tap-RA 2130 CG7659-RA 5..2130 1..2126 10630 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
tap-PA 398 CG7659-PA 1..398 108..1301 1853 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17359686..17361812 1..2127 10635 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17352786..17354912 1..2127 10635 100 Plus
Blast to na_te.dros performed 2014-11-27 00:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6710..6835 995..1124 162 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6795..6856 1024..1085 148 71 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2262..2380 965..1084 146 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6759..6819 1024..1084 143 70.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2289..2431 939..1081 138 56.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2422 1024..1117 136 61.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6716..6864 969..1120 131 59.6 Plus
roo 9092 roo DM_ROO 9092bp 1089..1146 1024..1081 128 69 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 966..1029 1020..1085 127 70.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6753..6843 1024..1117 120 61.7 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7928..7994 1002..1068 119 64.2 Plus
TART-C 11124 TART-C TARTC 11124bp 9372..9438 1002..1068 119 64.2 Plus
roo 9092 roo DM_ROO 9092bp 1057..1145 974..1068 118 63.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6813..6857 1024..1068 117 73.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2389 1034..1117 114 62.8 Plus

RE52048.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:34:41 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17349137..17351262 1..2126 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:21:34 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 1..1197 108..1304 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:54 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 1..1197 108..1304 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:09 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 1..1197 108..1304 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:21 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 1..1197 108..1304 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:34:41 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 1..1197 108..1304 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:54 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 37..2162 1..2126 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:54 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 37..2162 1..2126 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:09 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 5..2130 1..2126 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:21 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 37..2162 1..2126 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:34:41 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
tap-RA 5..2130 1..2126 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:34:41 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17359686..17361811 1..2126 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:09 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17352786..17354911 1..2126 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:32 Download gff for RE52048.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17352786..17354911 1..2126 100   Plus

RE52048.pep Sequence

Translation from 107 to 1303

> RE52048.pep
MAACYNAYSAGSQSFEFDEDDDDASFDSGYEKSFETEAQLSSRRRLDFGT
PPTPAIPQPYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLN
SRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVK
IKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAH
NYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPL
FGRMFPYGQGMAPLAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFT
GSMRFYHQQQQQPHQPHHLQPNPQQESSPQQFSQEKYDLFRGSFDAAANL
HSTNLDSGIHQQSSFYSQTPPWKDYPEDQAHVHPVPHQHSYKNFAPQV*

RE52048.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10169-PA 398 GF10169-PA 1..398 1..398 1330 74.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13612-PA 407 GG13612-PA 1..407 1..398 1839 93.9 Plus
Dere\GG21298-PA 392 GG21298-PA 143..214 141..212 162 43.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16587-PA 400 GH16587-PA 1..400 1..398 1199 67.8 Plus
Dgri\GH19754-PA 189 GH19754-PA 80..167 127..214 152 37.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
tap-PA 398 CG7659-PA 1..398 1..398 2136 100 Plus
dimm-PB 390 CG8667-PB 108..214 91..212 156 36.9 Plus
dimm-PA 390 CG8667-PA 108..214 91..212 156 36.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12435-PA 388 GI12435-PA 1..368 1..378 1230 70.1 Plus
Dmoj\GI12220-PA 413 GI12220-PA 133..205 140..212 163 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15578-PA 412 GL15578-PA 1..412 1..398 1401 73.5 Plus
Dper\GL26661-PA 421 GL26661-PA 138..209 141..212 162 43.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:12:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20508-PA 412 GA20508-PA 1..412 1..398 1394 73 Plus
Dpse\GA21247-PA 421 GA21247-PA 138..209 141..212 162 43.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:12:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25695-PA 398 GM25695-PA 1..398 1..398 1873 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14703-PA 398 GD14703-PA 1..398 1..398 1887 97.7 Plus
Dsim\GD24318-PA 386 GD24318-PA 141..212 141..212 162 43.1 Plus
Dsim\GD25551-PA 188 GD25551-PA 69..161 124..213 156 38.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12331-PA 390 GJ12331-PA 1..390 1..398 1225 68.6 Plus
Dvir\GJ22019-PA 197 GJ22019-PA 79..175 120..214 164 35.7 Plus
Dvir\ato-PA 325 GJ10529-PA 244..324 122..210 164 43.8 Plus
Dvir\GJ17849-PA 418 GJ17849-PA 145..231 149..230 159 36.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:12:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16635-PA 424 GK16635-PA 1..424 1..398 1254 68.2 Plus
Dwil\GK18738-PA 392 GK18738-PA 140..211 141..212 160 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19908-PA 401 GE19908-PA 1..401 1..398 1842 95 Plus

RE52048.hyp Sequence

Translation from 107 to 1303

> RE52048.hyp
MAACYNAYSAGSQSFEFDEDDDDASFDSGYEKSFETEAQLSSRRRLDFGT
PPTPAIPQPYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLN
SRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVK
IKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAH
NYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPL
FGRMFPYGQGMAPLAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFT
GSMRFYHQQQQQPHQPHHLQPNPQQESSPQQFSQEKYDLFRGSFDAAANL
HSTNLDSGIHQQSSFYSQTPPWKDYPEDQAHVHPVPHQHSYKNFAPQV*

RE52048.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
tap-PA 398 CG7659-PA 1..398 1..398 2136 100 Plus
dimm-PB 390 CG8667-PB 108..214 91..212 156 36.9 Plus
dimm-PA 390 CG8667-PA 108..214 91..212 156 36.9 Plus