Clone RE52822 Report

Search the DGRC for RE52822

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:528
Well:22
Vector:pFlc-1
Associated Gene/Transcriptvlc-RB
Protein status:RE52822.pep: gold
Sequenced Size:2379

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
vlc-RD 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE52822.complete Sequence

2379 bp assembled on 2009-10-16

GenBank Submission: BT100113.1

> RE52822.complete
ATGGCGTTTTTAATGTCCAGGTCATGGCAACACAACCGCTGTTCACCGAT
CAGTTTTTATTGGTTTTCAGGAATAAGTAAATTGGATTATTGAAGGCTTC
ACTTGGCTCAGTTTTCATGGATCGCAGTCTGGACTCTATTGGCAGCTGTT
CACTGGATGTAGACGCCGACTCCTCCGATATATCAGATACCAGTGGGAGC
CTGAACTTTCCAACGCCGGTCTCAGTAAGGGACATAACACGCGAATTTAC
TGCCAACCTTCGGGAGCGCTGTGTGCCTAACTTGCCTCCCCAGCCTCAGC
ACAAAACCCCTGCCTACGTTGAATCCAGGTCGTCAGAGCTGGAGCACATG
GTGCTGTCACCTGCAATTGTGGAGTGCGACCAAGAGCCGAGCTCCAATGA
TTTTGACGAGACTTCTGCAGAAAATTCACAAGAAGCTCCCGAAAAGAAGC
CCAGCTATTTAAACCTGGCTTGCTGCGTCAACGGTTATTCCAACCTTACC
ACCTACGACTCCAAGATTCGGCAGGACATAAACAAGTCACCGACACCAAC
TCTGCACAGCATGCCTTCTCCGGCCACCAAGTGCAAACCCATCGAGCCTA
ACAACAACAGCAACGACAGTAGCGGGAATTTTAGTTCGGGTTCTGGTCAC
AGCAATGGAAATGGCAGTTTTATCAAGCAACGGGTGGAGCGACTTTACGG
GCCGGGTGCATTAGCCCAGGGTTTCTACAGCCCCAAAAAGCACGGCCAGT
CACCATCGAATGCTGCAGGGCGATCGGAAAGGGGGCAGGTGGAGATCGAC
TCTCTACAAGGCTCCGAACTGGCTCGGAAATTCAAGCAGCTCTCCCCCAG
TAAAGACTATGGGGAGTTTCGAAAAAAAATGCAGAAGAAGTGTTCTCAGA
GTACAACGGCGAGGATAGACGAGCCGTTGCATTCTCCAGGGCTTAACGGA
GATCTTGACCTGCCCGTGTTTAGGCACCTTAGTCAAGAGTTCCGCGCCCA
GTTGCCTACTGTGTCACCAAAAAGGGGTGCTCCTCGATCTTGCATGGCTC
CTGATGTACTGCTTGTAGATAACGAGTCAAGTCCAGACCATGGTCCCACA
GATGAAGTAGACCACGAATCCACAAAAATGGACAAACTAGCCTCAGAGGA
ATACATCAGCACTTCCAATATTTCTGTTGAAGCTGTTGTTAAGGATGGAA
ATTTCTTTCTGAAAATACTAAAAGAGGAACAAAGCCGTCTCTTGGTGCTA
GCCGCTCTTGCTGAAAAATATGCAGACGCCTTGTCTACAAATCCAGATAT
CTCCGAAGATACCTTTGGGCTACTGCGATCAGCGTCGGGTAAGGCCCGTC
TCTTGGTATCGCAGAAAATGAAACAATTCGAGGGTCTTTGCCACAATAAT
CTGAATCGCTCACCAGAGGATAAGTTTCCAACAACTCTGGATGATTTACA
AGGATTCTGGGATATGGTTTATTTGCAGGTGGAGCACGTGGATTCTATTT
TTGCTGATATAGAGAAACTCAAAAGTAACGACTGGAAGGTAAAAGCACAG
TCCGTCGCTGACCAACCCGATTTGCACACCATACCAACTAAGACAATAAA
GCCGTCAAAAGTCGGTGTTTCGCAAGTGAAAACAGTCGGAAAGGCATCCA
GCGTTCGTGTGAATGGCTCGGCACCTCCCCCACCTAACTCGGCAGCAGCT
TTAAAGAGGGAGGCCCAGAGAAAACTGCTTCTAGAGATGAAACGTCAGCG
TCGCGAGGCTATGACCGCAGCGGCCAAATTGAATCCCATAAATGTTGATG
CCGACCCGGACGTGCCGGGAATAATTGGCGATAGTTGTGCTAATCCTAGC
GTTAGCAACGGAAGTTAAATAATGCTCACTGCGAATAGCAACTCATGCTT
TCTATTTATACATATATTTTTAACTAACACACGTGTACCCCACAAAGGCA
TACTTAAATTTATAGATATTTCTAGTTGAATTAATCATTTACTAGTCCCA
ACTAAAATTATTGTGTTGGAGCTCCTCACTGAAATCTGTCACAAGGCGTC
AAATATCTAGGAGATAACGAAGTATTGTCACCAATTGCGACTTACCTAAA
GTTGTTCATAAATATTGCCTTATCCGCGAAAGATTTCGCTAATTAATCAA
TTTGCTGTGCACATTATGTAATTGAAAATTAAAATTACTTGATTACATAT
AAAAAAGACATTTATTCACGTTTTACATTATTTAAGTATTTTAAAAACCA
ACAAAATTTTTGTATAACATAATTTGATGTTTTATAATTATTTTTGAGAA
ATTTAACTTATACAACTCTTGGAATATCATTTCTATTAATAGGCAAAATA
TTTTTATACAACTGAAAAAAAAAAAAAAA

RE52822.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
vlc.h 2470 vlc.h 188..2456 106..2374 11315 99.9 Plus
vlc-RA 2538 vlc-RA 691..2524 541..2374 9140 99.8 Plus
vlc-RE 2631 vlc-RE 784..2617 541..2374 9140 99.8 Plus
vlc-RA 2538 vlc-RA 190..624 106..540 2175 100 Plus
vlc-RE 2631 vlc-RE 283..717 106..540 2175 100 Plus
vlc.h 2470 vlc.h 6..112 1..107 535 100 Plus
vlc-RA 2538 vlc-RA 8..114 1..107 535 100 Plus
vlc-RE 2631 vlc-RE 6..112 1..107 535 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1591807..1592788 1383..2364 4895 99.9 Plus
chr2R 21145070 chr2R 1590844..1591589 541..1286 3730 100 Plus
chr2R 21145070 chr2R 1590421..1590777 184..540 1785 100 Plus
chr2R 21145070 chr2R 1589485..1589591 1..107 535 100 Plus
chr2R 21145070 chr2R 1591659..1591757 1287..1385 495 100 Plus
chr2R 21145070 chr2R 1590239..1590320 105..186 410 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-RB 1752 CG8390-PB 1..1752 117..1868 8760 100 Plus
vlc-RI 1818 CG8390-PI 491..1818 541..1868 6640 100 Plus
vlc-RH 1818 CG8390-PH 491..1818 541..1868 6640 100 Plus
vlc-RI 1818 CG8390-PI 1..424 117..540 2120 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:01:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-RB 2388 CG8390-RB 1..2364 1..2364 11820 100 Plus
vlc-RI 2425 CG8390-RI 578..2401 541..2364 9120 100 Plus
vlc-RH 2369 CG8390-RH 522..2345 541..2364 9120 100 Plus
vlc-RI 2425 CG8390-RI 77..511 106..540 2175 100 Plus
vlc-RI 2425 CG8390-RI 1..77 1..77 385 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-PB 583 CG8390-PB 1..583 117..1865 2800 100 Plus
vlc-PI 605 CG8390-PI 1..605 117..1865 2759 96.2 Plus
vlc-PH 605 CG8390-PH 1..605 117..1865 2759 96.2 Plus
vlc-PG 605 CG8390-PG 1..605 117..1865 2759 96.2 Plus
vlc-PF 605 CG8390-PF 1..605 117..1865 2759 96.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5704434..5705425 1383..2374 4930 99.8 Plus
2R 25286936 2R 5703471..5704216 541..1286 3730 100 Plus
2R 25286936 2R 5703048..5703404 184..540 1785 100 Plus
2R 25286936 2R 5702112..5702218 1..107 535 100 Plus
2R 25286936 2R 5704286..5704384 1287..1385 495 100 Plus
2R 25286936 2R 5702866..5702947 105..186 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5705633..5706624 1383..2374 4930 99.7 Plus
2R 25260384 2R 5704670..5705415 541..1286 3730 100 Plus
2R 25260384 2R 5704247..5704603 184..540 1785 100 Plus
2R 25260384 2R 5703311..5703417 1..107 535 100 Plus
2R 25260384 2R 5705485..5705583 1287..1385 495 100 Plus
2R 25260384 2R 5704065..5704146 105..186 410 100 Plus
Blast to na_te.dros performed 2014-11-27 03:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 3831..3967 2161..2300 143 57.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5601..5673 551..623 122 63 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1854..1960 1259..1153 120 60.6 Minus
Tabor 7345 Tabor TABOR 7345bp 6718..6823 2173..2275 116 60.4 Plus

RE52822.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:39:19 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1591808..1592788 1384..2364 99   Plus
chr2R 1591659..1591755 1287..1383 100 -> Plus
chr2R 1590844..1591589 541..1286 100 -> Plus
chr2R 1590424..1590777 187..540 100 -> Plus
chr2R 1590246..1590320 112..186 100 -> Plus
chr2R 1589485..1589593 1..111 97 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:58:33 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 1..1752 117..1868 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:45:22 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 1..1752 117..1868 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:56:29 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 1..1752 117..1868 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:39:19 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 1..1752 117..1868 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-16 16:29:27 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 6..2367 1..2364 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:45:22 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 6..2369 1..2364 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:56:29 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 1..2364 1..2364 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:39:19 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
vlc-RB 1..2364 1..2364 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:39:19 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5704435..5705415 1384..2364 100   Plus
2R 5704286..5704382 1287..1383 100 -> Plus
2R 5703471..5704216 541..1286 100 -> Plus
2R 5703051..5703404 187..540 100 -> Plus
2R 5702873..5702947 112..186 100 -> Plus
2R 5702112..5702220 1..111 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:29 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1591940..1592920 1384..2364 100   Plus
arm_2R 1591791..1591887 1287..1383 100 -> Plus
arm_2R 1590976..1591721 541..1286 100 -> Plus
arm_2R 1590556..1590909 187..540 100 -> Plus
arm_2R 1590378..1590452 112..186 100 -> Plus
arm_2R 1589617..1589725 1..111 97 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:25:46 Download gff for RE52822.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5705634..5706614 1384..2364 100   Plus
2R 5705485..5705581 1287..1383 100 -> Plus
2R 5704670..5705415 541..1286 100 -> Plus
2R 5704250..5704603 187..540 100 -> Plus
2R 5704072..5704146 112..186 100 -> Plus
2R 5703311..5703419 1..111 97 -> Plus

RE52822.pep Sequence

Translation from 116 to 1867

> RE52822.pep
MDRSLDSIGSCSLDVDADSSDISDTSGSLNFPTPVSVRDITREFTANLRE
RCVPNLPPQPQHKTPAYVESRSSELEHMVLSPAIVECDQEPSSNDFDETS
AENSQEAPEKKPSYLNLACCVNGYSNLTTYDSKIRQDINKSPTPTLHSMP
SPATKCKPIEPNNNSNDSSGNFSSGSGHSNGNGSFIKQRVERLYGPGALA
QGFYSPKKHGQSPSNAAGRSERGQVEIDSLQGSELARKFKQLSPSKDYGE
FRKKMQKKCSQSTTARIDEPLHSPGLNGDLDLPVFRHLSQEFRAQLPTVS
PKRGAPRSCMAPDVLLVDNESSPDHGPTDEVDHESTKMDKLASEEYISTS
NISVEAVVKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTF
GLLRSASGKARLLVSQKMKQFEGLCHNNLNRSPEDKFPTTLDDLQGFWDM
VYLQVEHVDSIFADIEKLKSNDWKVKAQSVADQPDLHTIPTKTIKPSKVG
VSQVKTVGKASSVRVNGSAPPPPNSAAALKREAQRKLLLEMKRQRREAMT
AAAKLNPINVDADPDVPGIIGDSCANPSVSNGS*

RE52822.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 10:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11028-PA 521 GF11028-PA 1..516 1..476 1466 62.9 Plus
Dana\GF13697-PA 959 GF13697-PA 600..730 352..473 171 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 10:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23178-PA 582 GG23178-PA 1..582 1..583 2676 88.7 Plus
Dere\GG19263-PA 169 GG19263-PA 1..166 338..516 390 50.3 Plus
Dere\GG20384-PA 909 GG20384-PA 547..684 341..473 184 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 10:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21456-PA 647 GH21456-PA 1..636 1..582 1547 53.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 10:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-PB 583 CG8390-PB 1..583 1..583 3016 100 Plus
vlc-PI 605 CG8390-PI 1..605 1..583 2975 96.2 Plus
vlc-PH 605 CG8390-PH 1..605 1..583 2975 96.2 Plus
vlc-PG 605 CG8390-PG 1..605 1..583 2975 96.2 Plus
vlc-PF 605 CG8390-PF 1..605 1..583 2975 96.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 10:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19933-PA 628 GI19933-PA 1..596 1..549 1422 52.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 10:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17527-PA 628 GL17527-PA 1..628 1..583 1616 57.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 10:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21040-PB 597 GA21040-PB 1..597 1..583 1620 59.7 Plus
Dpse\GA21040-PA 628 GA21040-PA 1..628 1..583 1616 57.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 10:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16518-PA 586 GM16518-PA 1..586 1..583 2755 95.2 Plus
Dsec\GM21472-PA 929 GM21472-PA 564..712 346..484 183 34 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 10:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10382-PA 1053 GD10382-PA 469..1053 1..583 2748 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 10:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\vlc-PA 632 GJ15100-PA 1..611 1..554 1495 53.5 Plus
Dvir\GJ19758-PA 636 GJ19758-PA 328..425 402..500 159 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 10:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\vlc-PA 624 GK10764-PA 1..613 1..573 1598 55.3 Plus
Dwil\GK15960-PA 957 GK15960-PA 579..739 352..512 186 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 10:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20549-PA 620 GE20549-PA 41..620 1..583 2633 87.5 Plus
Dyak\GE15882-PA 124 GE15882-PA 11..124 361..474 389 66.7 Plus
Dyak\GE12546-PA 923 GE12546-PA 566..708 350..484 178 34 Plus

RE52822.hyp Sequence

Translation from 116 to 1867

> RE52822.hyp
MDRSLDSIGSCSLDVDADSSDISDTSGSLNFPTPVSVRDITREFTANLRE
RCVPNLPPQPQHKTPAYVESRSSELEHMVLSPAIVECDQEPSSNDFDETS
AENSQEAPEKKPSYLNLACCVNGYSNLTTYDSKIRQDINKSPTPTLHSMP
SPATKCKPIEPNNNSNDSSGNFSSGSGHSNGNGSFIKQRVERLYGPGALA
QGFYSPKKHGQSPSNAAGRSERGQVEIDSLQGSELARKFKQLSPSKDYGE
FRKKMQKKCSQSTTARIDEPLHSPGLNGDLDLPVFRHLSQEFRAQLPTVS
PKRGAPRSCMAPDVLLVDNESSPDHGPTDEVDHESTKMDKLASEEYISTS
NISVEAVVKDGNFFLKILKEEQSRLLVLAALAEKYADALSTNPDISEDTF
GLLRSASGKARLLVSQKMKQFEGLCHNNLNRSPEDKFPTTLDDLQGFWDM
VYLQVEHVDSIFADIEKLKSNDWKVKAQSVADQPDLHTIPTKTIKPSKVG
VSQVKTVGKASSVRVNGSAPPPPNSAAALKREAQRKLLLEMKRQRREAMT
AAAKLNPINVDADPDVPGIIGDSCANPSVSNGS*

RE52822.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
vlc-PB 583 CG8390-PB 1..583 1..583 3016 100 Plus
vlc-PI 605 CG8390-PI 1..605 1..583 2975 96.2 Plus
vlc-PH 605 CG8390-PH 1..605 1..583 2975 96.2 Plus
vlc-PG 605 CG8390-PG 1..605 1..583 2975 96.2 Plus
vlc-PF 605 CG8390-PF 1..605 1..583 2975 96.2 Plus