Clone RE55168 Report

Search the DGRC for RE55168

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:551
Well:68
Vector:pFlc-1
Associated Gene/TranscriptAnk2-RE
Protein status:RE55168.pep: gold
Sequenced Size:2749

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32375 2003-01-01 Sim4 clustering to Release 3
Ank2 2008-04-29 Release 5.5 accounting
Ank2 2008-08-15 Release 5.9 accounting
Ank2 2008-12-18 5.12 accounting
CG42734 2011-03-01 Transcript Validation

Clone Sequence Records

RE55168.complete Sequence

2749 bp (2749 high quality bases) assembled on 2005-10-06

GenBank Submission: BT023884

> RE55168.complete
ATCATTAAATCAGCATCCGCAGCCATCCAAAGTCGTAATCAGCCGTTGAA
GCGAGTGGTATCTCTTATCAGCCAGGCCAGGCGCATAAAACTGGGTCCGG
TTAAAGCTCTTCCGCCACGACGAGGACGAACGCGCACAGCCGAGCTGGAG
CCGAAGTGGTTCGGGTGGTGCGATGGCGGGTGGCGAGTCCTGTGGCGTCT
AAGGCCCAACTGGGATAGCTGCTCCTAGTCAGTCATTTGACATTGCTCCT
GCGAGAAGGTTGTCCACGGTCCGAGCCCAAATCCTCCGTCGCCCACAACT
CGTCCGCAAGCCAGCCGTAGTGTGTGTTTTTTTGTGCTACCCACTCCCAC
TTTTGGGATACATATAAAAGTGCCACCCCCGCCTTCCCAAAAAAAAAAAC
CGCCTCATAGAGGAGTGAAATTTTAAACAAGTGTTACCTAAGCCCAAACC
TCAAAGAAACCATAACAAAAAGGGAGCAGTAGTTGAAGGTTGCGGCAAAA
TGGCCCAGTTTGTGACCCACATCCAGCCAACGCTGATGGAGGCGTCCCAA
GGTCATGTTCCTCACCACCACGGACATCAGGTGGGTGTGCAGCACTCGTC
GCATCTGCCCCACAGCGGCCACAACATGCCCTCGCCGCCAACCCACAATC
ACCATCATGCCCACGGACATGGTCATCATACCAGCAGCGGTGGTCATCAT
GGAGGAGCAGGTGGCCATTCACAGAAGCAGGCAGCGCATCATAGCACCAC
CTCCGGCCACGCCGCCAAGGGACAGCACCACAGCCCACCGTCGAGGATCC
ATTCACCGCCAACGGAACACCATCCGGATCATGTCGGTCACTACGAGTAC
TTCCAGCATCAGCACGAGCAGATCTTCCACCATGAAGGAGCAAACGGTGG
TGCCAGCCACAAGCAACAGACCCACCACCATCCCAACAAGCACGAGCACT
GCCCCACAGGACACCAGAGTGCGGGCGATGGAAACACTTCCTTCCTGCGT
GCCGCTCGCGCCGGAAATCTGGAGCGAGTGCTCGAGCATTTGAAGAACAA
CATTGACATTAACACCAGCAATGCGAATGGCTTGAATGCCCTGCACCTGG
CCTCCAAGGATGGCCACATCCACGTCGTCTCGGAACTCCTTCGTAGGGGC
GCGATTGTGGATAGTGCCACCAAAAAGGGAAACACTGCCCTCCACATCGC
CTCATTGGCTGGACAGGAGGAGGTGGTGAAGCTACTGCTGGAGCACAATG
CCTCCGTAAATGTGCAATCCCAGAATGGATTCACTCCACTCTACATGGCT
GCCCAGGAGAACCACGATGCTGTGGTGCGTCTCCTTTTGTCCAACGGAGC
CAACCAGAGTCTGGCCACCGAGGATGGCTTCACCCCACTGGCGGTGGCCA
TGCAGCAGGGTCATGACAAAGTCGTTGCTGTCCTCCTCGAGAGTGATACT
CGTGGAAAGGTCAGGCTTCCTGCGCTGCACATTGCCGCCAAAAAGGACGA
CGTCAAGGCAGCGACTCTGCTTCTCGATAATGACCATAATCCGGACGTGA
CTTCCAAGTCGGGCTTCACCCCGCTGCACATTGCTTCCCATTATGGTAAC
CAAAACATCGCCAACCTACTCATCCAGAAGGGCGCCGATGTCAACTACTC
GGCCAAGCACAACATCAGTCCGCTGCATGTGGCTGCTAAGTGGGGTAAGA
CCAACATGGTTTCCCTGCTTTTGGAAAAAGGTGGTAACATCGAGGCAAAG
ACCCGGGACGGACTTACTCCGCTCCATTGCGCCGCTCGCTCGGGTCATGA
GCAAGTTGTTGACATGCTACTCGAACGAGGAGCTCCCATCTCTGCCAAGA
CCAAAAATGGTTTGGCACCCCTCCATATGGCCGCCCAGGGTGAGCATGTT
GATGCCGCCCGCATCCTCTTGTACCATCGTGCTCCCGTCGACGAGGTGAC
AGTGGATTATCTCACTGCTCTTCATGTGGCTGCTCACTGTGGTCATGTTA
GGGTGGCTAAGCTTTTACTAGATCGGAATGCTGATGCCAATGCAAGGGCT
TTGAATGGATTCACTCCACTGCACATTGCCTGCAAGAAGAACCGCTTGAA
GGTGGTAGAGTTGCTCTTGCGACATGGTGCCAGCATTAGTGCCACGACAG
AGAGTGGACTTACTCCGCTCCATGTGGCCGCCTTTATGGGTTGCATGAAC
ATTGTCATCTATCTGCTGCAGCACGATGCCAGTCCCGATGTGCCCACTGT
GCGCGGAGAAACGCCACTCCATTTGGCCGCCAGAGCCAACCAGACCGACA
TCATTCGAATCCTGCTGCGCAATGGCGCCCAGGTGGACGCTCGTGCCCGA
GAGCAACAGACACCGCTGCACATCGCTTCGCGACTGGGTAATGTAGACAT
CGTGATGCTTCTGCTGCAACATGGCGCCCAAGTGGACGCAACCACCAAGG
ACATGTACACGGCACTTCACATCGCTGCCAAGGAGGGCCAGGATGAGGTA
AAAGATCTGATTGCGAAAAAGATCACCGACCACATCGACACCGTTTATCT
GATGCAACTGTTTTGGATACGCCATCAGGAGTTTTTCATTTGATTTTAAG
TTTTCCTCATGGCTTTTTGAGTTTTGTACTTGAATCGGTATTATGAGTTG
TTTTATAACTCTTGTGTTGTTGTTTCTTTTTGCCGTTTTGTTTTCGAATA
AATGTTGCAACTCTTTTTTTATGTAAAAAAAAGAAAAAAAAAAAAAAAA

RE55168.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-RE 2747 Ank2-RE 24..2747 1..2724 13605 99.9 Plus
Ank2-RK 14323 Ank2-RK 15..2513 1..2499 12480 99.9 Plus
Ank2.a 2289 Ank2.a 538..2289 973..2724 8760 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:19:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7709496..7710469 974..1 4840 99.8 Minus
chr3L 24539361 chr3L 7701645..7702409 2293..1529 3690 98.8 Minus
chr3L 24539361 chr3L 7702475..7702928 1528..1075 2255 99.8 Minus
chr3L 24539361 chr3L 7701050..7701485 2725..2290 2150 99.5 Minus
chr3L 24539361 chr3L 7702994..7703096 1075..973 515 100 Minus
chr4 1351717 chr4 143044..143201 2088..1931 250 77.2 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-RE 2094 CG42734-PE 1..2094 500..2593 10470 100 Plus
Ank2-RK 12795 CG42734-PK 1..2000 500..2499 10000 100 Plus
Ank2-RR 13491 CG42734-PR 1..2000 500..2499 10000 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-RE 2780 CG42734-RE 57..2780 1..2724 13605 100 Plus
Ank2-RK 14309 CG42734-RK 57..2555 1..2499 12480 100 Plus
Ank2-RR 15005 CG42734-RR 57..2555 1..2499 12480 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:19:41
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-PE 697 CG34416-PE 1..694 500..2581 2984 100 Plus
Ank2-PK 4264 CG34416-PK 1..667 500..2500 2840 100 Plus
Ank2-PR 4496 CG34416-PR 1..667 500..2500 2840 100 Plus
Ank2-PW 1309 CG42734-PW 1..667 500..2500 2840 100 Plus
Ank2-PV 4373 CG42734-PV 1..667 500..2500 2840 100 Plus
Ank2-PK 4264 CG34416-PK 355..902 980..2512 841 36.1 Plus
Ank2-PR 4496 CG34416-PR 355..902 980..2512 841 36.1 Plus
Ank2-PW 1309 CG42734-PW 355..902 980..2512 841 36.1 Plus
Ank2-PK 4264 CG34416-PK 420..944 977..2542 831 38.6 Plus
Ank2-PR 4496 CG34416-PR 420..944 977..2542 831 38.6 Plus
Ank2-PW 1309 CG42734-PW 420..944 977..2542 831 38.6 Plus
Ank2-PK 4264 CG34416-PK 329..838 1001..2518 811 36.3 Plus
Ank2-PR 4496 CG34416-PR 329..838 1001..2518 811 36.3 Plus
Ank2-PW 1309 CG42734-PW 329..838 1001..2518 811 36.3 Plus
Ank2-PK 4264 CG34416-PK 160..541 1373..2518 522 36.3 Plus
Ank2-PR 4496 CG34416-PR 160..541 1373..2518 522 36.3 Plus
Ank2-PW 1309 CG42734-PW 160..541 1373..2518 522 36.3 Plus
Ank2-PK 4264 CG34416-PK 168..512 1484..2530 492 34.7 Plus
Ank2-PR 4496 CG34416-PR 168..512 1484..2530 492 34.7 Plus
Ank2-PW 1309 CG42734-PW 168..512 1484..2530 492 34.7 Plus
Ank2-PK 4264 CG34416-PK 758..1003 902..1606 249 27.3 Plus
Ank2-PR 4496 CG34416-PR 758..1003 902..1606 249 27.3 Plus
Ank2-PK 4264 CG34416-PK 745..925 962..1492 247 32 Plus
Ank2-PR 4496 CG34416-PR 745..925 962..1492 247 32 Plus
Ank2-PW 1309 CG42734-PW 745..925 962..1492 247 32 Plus
Ank2-PW 1309 CG42734-PW 758..932 902..1426 239 32 Plus
Ank2-PK 4264 CG34416-PK 161..317 2057..2527 212 31.2 Plus
Ank2-PR 4496 CG34416-PR 161..317 2057..2527 212 31.2 Plus
Ank2-PW 1309 CG42734-PW 161..317 2057..2527 212 31.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7717366..7718339 974..1 4855 99.9 Minus
3L 28110227 3L 7709519..7710283 2293..1529 3825 100 Minus
3L 28110227 3L 7710349..7710802 1528..1075 2270 100 Minus
3L 28110227 3L 7708919..7709354 2725..2290 2180 100 Minus
3L 28110227 3L 7710868..7710970 1075..973 515 100 Minus
4 1348131 4 122410..122567 2088..1931 250 77.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7710466..7711439 974..1 4855 99.8 Minus
3L 28103327 3L 7702619..7703383 2293..1529 3825 100 Minus
3L 28103327 3L 7703449..7703902 1528..1075 2270 100 Minus
3L 28103327 3L 7702019..7702454 2725..2290 2180 100 Minus
3L 28103327 3L 7703968..7704070 1075..973 515 100 Minus
4 1331231 4 122475..122567 2023..1931 225 82.7 Minus
4 1331231 4 123004..123125 1494..1373 175 76.2 Minus
Blast to na_te.dros performed on 2014-11-27 09:19:34 has no hits.

RE55168.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:19:43 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7709497..7710469 1..973 99   Minus
chr3L 7702994..7703095 974..1075 100 <- Minus
chr3L 7702475..7702927 1076..1528 99 <- Minus
chr3L 7701645..7702409 1529..2293 98 <- Minus
chr3L 7701050..7701481 2294..2725 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:23:56 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2094 500..2593 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:49:12 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2094 500..2593 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:15:15 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2094 500..2593 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:30:09 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2094 500..2593 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:19:43 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2094 500..2593 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:22:24 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2722 1..2722 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:49:12 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2722 1..2722 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:15:15 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 57..2780 1..2724 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:30:09 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 1..2722 1..2722 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:43 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
Ank2-RE 57..2780 1..2724 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:19:43 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7717367..7718339 1..973 99   Minus
3L 7710868..7710969 974..1075 100 <- Minus
3L 7710349..7710801 1076..1528 100 <- Minus
3L 7709519..7710283 1529..2293 100 <- Minus
3L 7708919..7709350 2294..2725 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:15:15 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7710467..7711439 1..973 99   Minus
arm_3L 7703968..7704069 974..1075 100 <- Minus
arm_3L 7703449..7703901 1076..1528 100 <- Minus
arm_3L 7702619..7703383 1529..2293 100 <- Minus
arm_3L 7702019..7702450 2294..2725 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:08:32 Download gff for RE55168.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7710467..7711439 1..973 99   Minus
3L 7703968..7704069 974..1075 100 <- Minus
3L 7703449..7703901 1076..1528 100 <- Minus
3L 7702619..7703383 1529..2293 100 <- Minus
3L 7702019..7702450 2294..2725 100 <- Minus

RE55168.pep Sequence

Translation from 499 to 2592

> RE55168.pep
MAQFVTHIQPTLMEASQGHVPHHHGHQVGVQHSSHLPHSGHNMPSPPTHN
HHHAHGHGHHTSSGGHHGGAGGHSQKQAAHHSTTSGHAAKGQHHSPPSRI
HSPPTEHHPDHVGHYEYFQHQHEQIFHHEGANGGASHKQQTHHHPNKHEH
CPTGHQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHL
ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHN
ASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA
MQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDV
TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGK
TNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAK
TKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHV
RVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT
ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTD
IIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK
DMYTALHIAAKEGQDEVKDLIAKKITDHIDTVYLMQLFWIRHQEFFI*

RE55168.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 21:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23770-PA 1529 GF23770-PA 3..517 153..667 2659 99 Plus
Dana\GF23392-PA 1577 GF23392-PA 30..542 157..667 1947 71.3 Plus
Dana\GF23770-PA 1529 GF23770-PA 225..752 181..671 824 36.6 Plus
Dana\GF23770-PA 1529 GF23770-PA 270..794 160..681 786 38.6 Plus
Dana\GF23770-PA 1529 GF23770-PA 179..688 168..673 777 36.5 Plus
Dana\GF23392-PA 1577 GF23392-PA 295..821 160..648 734 36.9 Plus
Dana\GF23392-PA 1577 GF23392-PA 167..710 160..671 716 36.1 Plus
Dana\GF16435-PA 2115 GF16435-PA 1248..1763 174..667 572 31.7 Plus
Dana\GF23392-PA 1577 GF23392-PA 70..417 323..674 537 40.1 Plus
Dana\GF14389-PA 1744 GF14389-PA 267..851 157..673 528 29.9 Plus
Dana\GF16435-PA 2115 GF16435-PA 1267..1796 160..667 521 31.1 Plus
Dana\GF14389-PA 1744 GF14389-PA 625..1201 123..672 498 30.1 Plus
Dana\GF19977-PA 467 GF19977-PA 1..458 245..667 478 28.9 Plus
Dana\GF14389-PA 1744 GF14389-PA 574..1144 187..686 474 30.6 Plus
Dana\GF14389-PA 1744 GF14389-PA 126..639 186..667 467 29.4 Plus
Dana\GF16435-PA 2115 GF16435-PA 1351..1800 166..605 459 31.8 Plus
Dana\GF23392-PA 1577 GF23392-PA 491..809 158..506 458 35.2 Plus
Dana\GF14389-PA 1744 GF14389-PA 370..918 160..671 440 29.3 Plus
Dana\GF16435-PA 2115 GF16435-PA 1236..1702 198..671 435 30.8 Plus
Dana\GF14389-PA 1744 GF14389-PA 232..761 190..687 393 26.7 Plus
Dana\GF16435-PA 2115 GF16435-PA 1444..1809 156..545 296 29.7 Plus
Dana\GF14389-PA 1744 GF14389-PA 92..452 353..667 242 28.2 Plus
Dana\GF23770-PA 1529 GF23770-PA 595..754 155..314 213 33.1 Plus
Dana\GF23770-PA 1529 GF23770-PA 660..797 187..338 212 36.2 Plus
Dana\GF16435-PA 2115 GF16435-PA 1232..1474 454..677 211 31.8 Plus
Dana\GF14389-PA 1744 GF14389-PA 130..364 421..679 189 29.4 Plus
Dana\GF16435-PA 2115 GF16435-PA 1636..1811 149..324 178 29.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 21:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14943-PA 1526 GG14943-PA 3..517 153..667 2659 99 Plus
Dere\GG16463-PA 1551 GG16463-PA 37..545 160..667 1966 72.9 Plus
Dere\GG14943-PA 1526 GG14943-PA 225..752 181..671 823 36.6 Plus
Dere\GG16463-PA 1551 GG16463-PA 222..781 149..673 784 36.2 Plus
Dere\GG14943-PA 1526 GG14943-PA 179..688 168..673 771 36.3 Plus
Dere\GG16463-PA 1551 GG16463-PA 299..804 160..663 753 37.5 Plus
Dere\GG16463-PA 1551 GG16463-PA 168..687 157..676 713 37 Plus
Dere\GG14943-PA 1526 GG14943-PA 357..782 181..602 709 38.3 Plus
Dere\GG14942-PA 185 GG14942-PA 1..161 1..161 616 93.2 Plus
Dere\GG16463-PA 1551 GG16463-PA 439..812 168..539 571 37.5 Plus
Dere\GG12063-PA 2124 GG12063-PA 1227..1771 137..667 568 31 Plus
Dere\GG16463-PA 1551 GG16463-PA 30..420 285..673 552 37.2 Plus
Dere\GG16463-PA 1551 GG16463-PA 494..812 158..506 529 36.7 Plus
Dere\GG25069-PA 1755 GG25069-PA 264..848 157..673 524 29.5 Plus
Dere\GG12063-PA 2124 GG12063-PA 1275..1804 160..667 522 31.3 Plus
Dere\GG12063-PA 2124 GG12063-PA 1354..1808 160..605 456 30.8 Plus
Dere\GG12063-PA 2124 GG12063-PA 1276..1710 227..671 430 31.6 Plus
Dere\GG12063-PA 2124 GG12063-PA 1452..1817 156..545 297 29.7 Plus
Dere\GG16463-PA 1551 GG16463-PA 74..259 488..677 232 34.2 Plus
Dere\GG14943-PA 1526 GG14943-PA 660..785 187..312 211 38.9 Plus
Dere\GG12063-PA 2124 GG12063-PA 1240..1482 454..677 211 31.3 Plus
Dere\GG12063-PA 2124 GG12063-PA 1647..1819 151..324 177 30.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 21:13:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16856-PA 1546 GH16856-PA 3..517 153..667 2658 99 Plus
Dgri\GH23945-PA 1653 GH23945-PA 15..529 155..667 2122 77.9 Plus
Dgri\GH16856-PA 1546 GH16856-PA 225..752 181..671 824 36.4 Plus
Dgri\GH23945-PA 1653 GH23945-PA 217..766 161..673 798 36.9 Plus
Dgri\GH16856-PA 1546 GH16856-PA 270..789 160..676 783 38.5 Plus
Dgri\GH16856-PA 1546 GH16856-PA 179..688 168..673 773 36.3 Plus
Dgri\GH23945-PA 1653 GH23945-PA 282..785 160..659 747 37.3 Plus
Dgri\GH23945-PA 1653 GH23945-PA 185..668 195..674 728 38 Plus
Dgri\GH23945-PA 1653 GH23945-PA 376..794 188..569 618 36.3 Plus
Dgri\GH16234-PA 2124 GH16234-PA 1212..1768 128..667 582 31.6 Plus
Dgri\GH23945-PA 1653 GH23945-PA 422..797 168..539 544 36.4 Plus
Dgri\GH10289-PA 1721 GH10289-PA 267..851 157..673 526 29.7 Plus
Dgri\GH23945-PA 1653 GH23945-PA 478..841 158..557 508 33.8 Plus
Dgri\GH10289-PA 1721 GH10289-PA 625..1201 123..672 501 29.8 Plus
Dgri\GH10289-PA 1721 GH10289-PA 574..1144 187..686 476 30.7 Plus
Dgri\GH18670-PA 4279 GH18670-PA 620..1115 157..641 462 33 Plus
Dgri\GH10289-PA 1721 GH10289-PA 126..639 186..667 461 29.7 Plus
Dgri\GH16234-PA 2124 GH16234-PA 1351..1805 160..605 457 30.8 Plus
Dgri\GH16234-PA 2124 GH16234-PA 1272..1805 160..638 439 28.3 Plus
Dgri\GH16234-PA 2124 GH16234-PA 1273..1707 227..671 433 32 Plus
Dgri\GH10289-PA 1721 GH10289-PA 370..918 160..671 431 29 Plus
Dgri\GH10289-PA 1721 GH10289-PA 232..761 190..687 394 26.9 Plus
Dgri\GH16234-PA 2124 GH16234-PA 1449..1814 156..545 305 30 Plus
Dgri\GH23945-PA 1653 GH23945-PA 609..789 157..366 264 33.8 Plus
Dgri\GH10289-PA 1721 GH10289-PA 92..452 353..667 234 27.3 Plus
Dgri\GH23945-PA 1653 GH23945-PA 39..242 465..677 232 31 Plus
Dgri\GH16856-PA 1546 GH16856-PA 595..754 155..314 221 33.8 Plus
Dgri\GH16234-PA 2124 GH16234-PA 1237..1479 454..677 207 30.9 Plus
Dgri\GH10289-PA 1721 GH10289-PA 130..364 421..679 187 29.3 Plus
Dgri\GH16234-PA 2124 GH16234-PA 1677..1816 184..324 176 31.9 Plus
Dgri\GH16856-PA 1546 GH16856-PA 639..787 120..281 157 35.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-PE 697 CG34416-PE 1..697 1..697 3684 100 Plus
Ank2-PK 4264 CG34416-PK 1..667 1..667 3524 100 Plus
Ank2-PR 4496 CG34416-PR 1..667 1..667 3524 100 Plus
Ank2-PW 1309 CG42734-PW 1..667 1..667 3524 100 Plus
Ank2-PV 4373 CG42734-PV 1..667 1..667 3524 100 Plus
Ank2-PK 4264 CG34416-PK 355..902 161..671 887 36.1 Plus
Ank2-PR 4496 CG34416-PR 355..902 161..671 887 36.1 Plus
Ank2-PW 1309 CG42734-PW 355..902 161..671 887 36.1 Plus
Ank2-PK 4264 CG34416-PK 420..944 160..681 864 38.6 Plus
Ank2-PR 4496 CG34416-PR 420..944 160..681 864 38.6 Plus
Ank2-PW 1309 CG42734-PW 420..944 160..681 864 38.6 Plus
Ank2-PK 4264 CG34416-PK 329..838 168..673 838 36.3 Plus
Ank2-PR 4496 CG34416-PR 329..838 168..673 838 36.3 Plus
Ank2-PW 1309 CG42734-PW 329..838 168..673 838 36.3 Plus
Ank2-PK 4264 CG34416-PK 160..541 292..673 565 36.3 Plus
Ank2-PR 4496 CG34416-PR 160..541 292..673 565 36.3 Plus
Ank2-PW 1309 CG42734-PW 160..541 292..673 565 36.3 Plus
Ank2-PK 4264 CG34416-PK 168..512 329..677 524 34.7 Plus
Ank2-PR 4496 CG34416-PR 168..512 329..677 524 34.7 Plus
Ank2-PW 1309 CG42734-PW 168..512 329..677 524 34.7 Plus
Ank2-PK 4264 CG34416-PK 758..1003 135..369 249 27.3 Plus
Ank2-PR 4496 CG34416-PR 758..1003 135..369 249 27.3 Plus
Ank2-PK 4264 CG34416-PK 745..925 155..331 247 32 Plus
Ank2-PR 4496 CG34416-PR 745..925 155..331 247 32 Plus
Ank2-PW 1309 CG42734-PW 745..925 155..331 247 32 Plus
Ank2-PW 1309 CG42734-PW 758..932 135..309 239 32 Plus
Ank2-PK 4264 CG34416-PK 160..317 519..676 213 31 Plus
Ank2-PR 4496 CG34416-PR 160..317 519..676 213 31 Plus
Ank2-PW 1309 CG42734-PW 160..317 519..676 213 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 21:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13078-PA 1540 GI13078-PA 3..517 153..667 2661 99 Plus
Dmoj\GI13078-PA 1540 GI13078-PA 225..752 181..671 829 36.6 Plus
Dmoj\GI13078-PA 1540 GI13078-PA 179..688 168..673 776 36.3 Plus
Dmoj\GI22180-PA 2153 GI22180-PA 1244..1800 128..667 581 31.4 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 269..853 157..673 529 29.7 Plus
Dmoj\GI22180-PA 2153 GI22180-PA 1341..1833 185..667 517 31.6 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 627..1203 123..672 500 29.8 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 595..1087 160..641 484 33.4 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 576..1146 187..686 477 30.7 Plus
Dmoj\GI22180-PA 2153 GI22180-PA 1383..1837 160..605 462 31 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 128..641 186..667 458 29.2 Plus
Dmoj\GI10353-PA 1185 GI10353-PA 178..756 165..671 444 29.2 Plus
Dmoj\GI22180-PA 2153 GI22180-PA 1273..1739 198..671 439 31 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 372..920 160..671 433 29.2 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 607..1057 201..677 423 32.1 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 234..763 190..687 398 26.9 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 2376..2699 262..575 388 35.2 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 2377..2697 197..507 387 34.3 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 2376..2701 357..676 365 32.3 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 2392..2729 340..671 351 31.1 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 2366..2699 220..542 348 33.8 Plus
Dmoj\GI22180-PA 2153 GI22180-PA 1481..1846 156..545 304 30 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 94..454 353..667 237 27.1 Plus
Dmoj\GI13078-PA 1540 GI13078-PA 595..754 155..314 219 33.1 Plus
Dmoj\GI13078-PA 1540 GI13078-PA 660..785 187..312 219 38.9 Plus
Dmoj\GI22180-PA 2153 GI22180-PA 1269..1511 454..677 205 30.9 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 2376..2557 522..693 192 32.2 Plus
Dmoj\GI17984-PA 1761 GI17984-PA 132..366 421..679 186 29.1 Plus
Dmoj\GI22180-PA 2153 GI22180-PA 1673..1848 149..324 178 29.4 Plus
Dmoj\GI13078-PA 1540 GI13078-PA 639..787 120..281 161 35.8 Plus
Dmoj\GI24181-PA 4101 GI24181-PA 2544..2698 162..314 159 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 21:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18390-PA 1700 GL18390-PA 140..649 160..667 2088 77.3 Plus
Dper\GL18390-PA 1700 GL18390-PA 402..908 160..663 781 38.6 Plus
Dper\GL18390-PA 1700 GL18390-PA 337..885 161..673 758 35.6 Plus
Dper\GL18390-PA 1700 GL18390-PA 305..777 195..663 710 37.4 Plus
Dper\GL18390-PA 1700 GL18390-PA 523..913 149..569 598 35.3 Plus
Dper\GL13699-PA 1657 GL13699-PA 747..1303 128..667 582 30.9 Plus
Dper\GL18390-PA 1700 GL18390-PA 177..523 323..673 555 40.2 Plus
Dper\GL25839-PA 1713 GL25839-PA 266..850 157..673 523 29.7 Plus
Dper\GL25839-PA 1713 GL25839-PA 624..1200 123..672 493 30.1 Plus
Dper\GL23419-PA 2532 GL23419-PA 566..1063 157..641 486 32.2 Plus
Dper\GL25839-PA 1713 GL25839-PA 573..1143 187..686 469 30.9 Plus
Dper\GL13699-PA 1657 GL13699-PA 886..1340 160..605 468 31.6 Plus
Dper\GL25839-PA 1713 GL25839-PA 125..638 186..667 462 29.2 Plus
Dper\GL13699-PA 1657 GL13699-PA 807..1340 160..638 452 28.5 Plus
Dper\GL13699-PA 1657 GL13699-PA 808..1242 227..671 438 31.8 Plus
Dper\GL25839-PA 1713 GL25839-PA 369..917 160..671 436 29.2 Plus
Dper\GL22305-PA 1187 GL22305-PA 179..726 165..673 424 30.6 Plus
Dper\GL25839-PA 1713 GL25839-PA 231..760 190..687 396 26.9 Plus
Dper\GL23419-PA 2532 GL23419-PA 577..1062 197..673 383 29.9 Plus
Dper\GL23419-PA 2532 GL23419-PA 572..996 259..673 360 31.4 Plus
Dper\GL13699-PA 1657 GL13699-PA 984..1349 156..545 300 29.9 Plus
Dper\GL23419-PA 2532 GL23419-PA 514..833 389..674 291 31.2 Plus
Dper\GL25839-PA 1713 GL25839-PA 91..451 353..667 241 27.6 Plus
Dper\GL13699-PA 1657 GL13699-PA 772..1014 454..677 206 31.3 Plus
Dper\GL25839-PA 1713 GL25839-PA 129..363 421..679 193 29.1 Plus
Dper\GL13699-PA 1657 GL13699-PA 1176..1351 149..324 180 29.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 21:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23604-PA 1519 GA23604-PA 3..517 153..667 2652 98.6 Plus
Dpse\GA14074-PA 1562 GA14074-PA 2..511 160..667 2087 77.3 Plus
Dpse\GA23604-PA 1519 GA23604-PA 225..752 181..671 822 36.6 Plus
Dpse\GA23604-PA 1519 GA23604-PA 270..789 160..676 783 38.7 Plus
Dpse\GA14074-PA 1562 GA14074-PA 264..770 160..663 783 38.6 Plus
Dpse\GA23604-PA 1519 GA23604-PA 179..688 168..673 770 35.9 Plus
Dpse\GA14074-PA 1562 GA14074-PA 199..747 161..673 760 35.6 Plus
Dpse\GA14074-PA 1562 GA14074-PA 167..639 195..663 712 37.4 Plus
Dpse\GA14074-PA 1562 GA14074-PA 385..775 149..569 599 35.3 Plus
Dpse\GA10007-PA 2111 GA10007-PA 1200..1756 128..667 580 30.9 Plus
Dpse\GA14074-PA 1562 GA14074-PA 39..385 323..673 556 40.2 Plus
Dpse\GA25465-PA 1756 GA25465-PA 266..850 157..673 524 29.7 Plus
Dpse\GA25465-PA 1756 GA25465-PA 624..1200 123..672 494 30.1 Plus
Dpse\GA27251-PA 4243 GA27251-PA 591..1088 157..641 481 32.5 Plus
Dpse\GA25465-PA 1756 GA25465-PA 573..1143 187..686 470 30.9 Plus
Dpse\GA10007-PA 2111 GA10007-PA 1339..1793 160..605 467 30.8 Plus
Dpse\GA25465-PA 1756 GA25465-PA 125..638 186..667 462 29.2 Plus
Dpse\GA10007-PA 2111 GA10007-PA 1260..1793 160..638 451 28.5 Plus
Dpse\GA10007-PA 2111 GA10007-PA 1261..1695 227..671 437 31.8 Plus
Dpse\GA25465-PA 1756 GA25465-PA 369..917 160..671 436 29.2 Plus
Dpse\GA25465-PA 1756 GA25465-PA 231..760 190..687 397 26.9 Plus
Dpse\GA10007-PA 2111 GA10007-PA 1437..1793 156..473 276 28.3 Plus
Dpse\GA25465-PA 1756 GA25465-PA 91..451 353..667 241 27.6 Plus
Dpse\GA23604-PA 1519 GA23604-PA 595..754 155..314 211 33.1 Plus
Dpse\GA10007-PA 2111 GA10007-PA 1225..1467 454..677 208 31.3 Plus
Dpse\GA25465-PA 1756 GA25465-PA 129..363 421..679 194 29.1 Plus
Dpse\GA10007-PA 2111 GA10007-PA 1629..1804 149..324 177 29.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 21:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23234-PA 1543 GM23234-PA 31..545 154..667 1957 72.9 Plus
Dsec\GM24995-PA 764 GM24995-PA 10..388 159..556 1274 67.3 Plus
Dsec\GM24995-PA 764 GM24995-PA 46..370 323..598 795 54.7 Plus
Dsec\GM23234-PA 1543 GM23234-PA 299..804 160..663 776 38.6 Plus
Dsec\GM23234-PA 1543 GM23234-PA 222..771 149..663 767 36.5 Plus
Dsec\GM24994-PA 181 GM24994-PA 1..158 1..158 618 96.2 Plus
Dsec\GM23234-PA 1543 GM23234-PA 439..812 168..539 577 38 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1221..1765 137..667 571 31.2 Plus
Dsec\GM23234-PA 1543 GM23234-PA 454..812 155..506 541 37.7 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1269..1798 160..667 519 31.3 Plus
Dsec\GM23234-PA 1543 GM23234-PA 74..420 323..673 514 38.7 Plus
Dsec\GM18546-PA 836 GM18546-PA 248..776 123..606 483 29.6 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1348..1802 160..605 454 30.8 Plus
Dsec\GM24995-PA 764 GM24995-PA 32..370 342..664 437 33.5 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1270..1704 227..671 427 31.6 Plus
Dsec\GM24995-PA 764 GM24995-PA 11..284 420..677 326 36.3 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1446..1811 156..545 295 29.7 Plus
Dsec\GM23234-PA 1543 GM23234-PA 36..259 481..677 230 29.8 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1234..1476 454..677 211 31.3 Plus
Dsec\GM16283-PA 2118 GM16283-PA 1638..1813 149..324 178 29.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 21:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13038-PA 1515 GD13038-PA 149..657 159..667 2659 100 Plus
Dsim\GD13038-PA 1515 GD13038-PA 365..892 181..671 821 36.4 Plus
Dsim\GD13038-PA 1515 GD13038-PA 319..828 168..673 777 36.5 Plus
Dsim\GD13038-PA 1515 GD13038-PA 497..922 181..602 715 38.5 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1233..1777 137..667 570 31.2 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1281..1810 160..667 518 31.3 Plus
Dsim\GD23336-PA 636 GD23336-PA 123..629 186..660 463 29.6 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1360..1814 160..605 453 31.6 Plus
Dsim\GD18183-PA 1181 GD18183-PA 180..727 165..673 434 30.8 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1282..1716 227..671 427 31.6 Plus
Dsim\GD18183-PA 1181 GD18183-PA 20..607 158..673 415 28 Plus
Dsim\GD18183-PA 1181 GD18183-PA 363..789 194..640 415 31.1 Plus
Dsim\GD18183-PA 1181 GD18183-PA 483..779 160..461 366 35.6 Plus
Dsim\GD22794-PA 321 GD22794-PA 13..296 392..675 330 33.7 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1458..1823 156..545 294 29.7 Plus
Dsim\GD23336-PA 636 GD23336-PA 264..621 157..455 279 27.7 Plus
Dsim\GD13038-PA 1515 GD13038-PA 153..370 489..677 249 32.1 Plus
Dsim\GD13038-PA 1515 GD13038-PA 185..400 488..674 246 33.8 Plus
Dsim\GD23336-PA 636 GD23336-PA 126..449 354..667 246 28.6 Plus
Dsim\GD18183-PA 1181 GD18183-PA 59..301 489..677 240 32.5 Plus
Dsim\GD13038-PA 1515 GD13038-PA 800..925 187..312 212 38.9 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1246..1488 454..677 211 31.3 Plus
Dsim\GD23336-PA 636 GD23336-PA 127..361 421..679 189 29.4 Plus
Dsim\GD18026-PA 2130 GD18026-PA 1650..1825 149..324 178 29.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 21:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13827-PA 1548 GJ13827-PA 13..523 157..667 2660 99.6 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 263..806 130..671 2106 73.9 Plus
Dvir\GJ13827-PA 1548 GJ13827-PA 231..758 181..671 828 36.6 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 478..1039 149..673 812 36.5 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 555..1058 160..659 786 38.3 Plus
Dvir\GJ13827-PA 1548 GJ13827-PA 185..694 168..673 774 36.3 Plus
Dvir\GJ13827-PA 1548 GJ13827-PA 363..816 181..594 658 34.8 Plus
Dvir\GJ24299-PA 2125 GJ24299-PA 1215..1771 128..667 582 31.4 Plus
Dvir\GJ19559-PA 1716 GJ19559-PA 270..854 157..673 534 30 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 751..1070 158..506 502 36.1 Plus
Dvir\GJ19559-PA 1716 GJ19559-PA 628..1204 123..672 492 29.9 Plus
Dvir\GJ19559-PA 1716 GJ19559-PA 577..1147 187..686 473 30.6 Plus
Dvir\GJ10528-PA 4141 GJ10528-PA 590..1082 160..641 471 32.8 Plus
Dvir\GJ19559-PA 1716 GJ19559-PA 128..642 185..667 464 29.2 Plus
Dvir\GJ24299-PA 2125 GJ24299-PA 1354..1808 160..605 451 30.8 Plus
Dvir\GJ24299-PA 2125 GJ24299-PA 1276..1710 227..671 435 32.3 Plus
Dvir\GJ19559-PA 1716 GJ19559-PA 235..764 190..687 394 26.9 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 783..1070 157..440 377 34 Plus
Dvir\GJ24299-PA 2125 GJ24299-PA 1452..1817 156..545 301 29.7 Plus
Dvir\GJ19213-PA 1869 GJ19213-PA 312..515 465..677 241 31.5 Plus
Dvir\GJ13827-PA 1548 GJ13827-PA 601..760 155..314 218 33.1 Plus
Dvir\GJ24299-PA 2125 GJ24299-PA 1240..1482 454..677 205 30.9 Plus
Dvir\GJ19559-PA 1716 GJ19559-PA 133..367 421..679 187 29.1 Plus
Dvir\GJ24299-PA 2125 GJ24299-PA 1644..1819 149..324 175 28.7 Plus
Dvir\GJ13827-PA 1548 GJ13827-PA 645..816 120..310 164 33.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 21:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24225-PA 1516 GK24225-PA 9..517 159..667 2655 99.8 Plus
Dwil\GK13612-PA 1761 GK13612-PA 52..566 155..667 2096 76.9 Plus
Dwil\GK24225-PA 1516 GK24225-PA 225..752 181..671 814 36.4 Plus
Dwil\GK13612-PA 1761 GK13612-PA 254..802 161..673 814 37.3 Plus
Dwil\GK24225-PA 1516 GK24225-PA 270..793 160..680 787 38.4 Plus
Dwil\GK13612-PA 1761 GK13612-PA 319..821 160..659 776 39.4 Plus
Dwil\GK24225-PA 1516 GK24225-PA 179..688 168..673 765 36.1 Plus
Dwil\GK13612-PA 1761 GK13612-PA 253..726 193..663 731 37.3 Plus
Dwil\GK10993-PA 2178 GK10993-PA 1275..1819 137..667 567 31.2 Plus
Dwil\GK15041-PA 1829 GK15041-PA 268..852 157..673 527 29.4 Plus
Dwil\GK10993-PA 2178 GK10993-PA 1360..1852 185..667 518 31.4 Plus
Dwil\GK15041-PA 1829 GK15041-PA 626..1202 123..672 499 30.1 Plus
Dwil\GK11389-PA 4181 GK11389-PA 552..1049 157..641 486 32.7 Plus
Dwil\GK15041-PA 1829 GK15041-PA 575..1145 187..686 476 30.7 Plus
Dwil\GK13612-PA 1761 GK13612-PA 515..833 158..506 468 35 Plus
Dwil\GK15041-PA 1829 GK15041-PA 127..640 186..667 468 29.4 Plus
Dwil\GK10993-PA 2178 GK10993-PA 1402..1856 160..605 463 31 Plus
Dwil\GK15041-PA 1829 GK15041-PA 371..919 160..671 441 29.3 Plus
Dwil\GK10993-PA 2178 GK10993-PA 1324..1758 227..671 429 31.8 Plus
Dwil\GK15041-PA 1829 GK15041-PA 233..762 190..687 396 26.9 Plus
Dwil\GK10993-PA 2178 GK10993-PA 1500..1865 156..545 293 29.5 Plus
Dwil\GK15041-PA 1829 GK15041-PA 90..453 350..667 242 27.1 Plus
Dwil\GK24225-PA 1516 GK24225-PA 660..798 187..339 222 37.3 Plus
Dwil\GK24225-PA 1516 GK24225-PA 595..754 155..314 218 33.8 Plus
Dwil\GK10993-PA 2178 GK10993-PA 1288..1530 454..677 210 31.7 Plus
Dwil\GK15041-PA 1829 GK15041-PA 131..365 421..679 185 28.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 21:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20395-PA 1535 GE20395-PA 3..517 153..667 2661 99 Plus
Dyak\GE14529-PA 1554 GE14529-PA 30..544 154..667 2000 73.1 Plus
Dyak\GE20395-PA 1535 GE20395-PA 225..752 181..671 823 36.6 Plus
Dyak\GE14529-PA 1554 GE14529-PA 221..780 149..673 801 36.5 Plus
Dyak\GE20395-PA 1535 GE20395-PA 179..688 168..673 771 36.3 Plus
Dyak\GE14529-PA 1554 GE14529-PA 298..803 160..663 771 38.4 Plus
Dyak\GE20395-PA 1535 GE20395-PA 357..801 181..621 711 37.8 Plus
Dyak\GE14529-PA 1554 GE14529-PA 384..811 177..605 655 35.8 Plus
Dyak\GE20394-PA 180 GE20394-PA 1..161 1..161 614 91.3 Plus
Dyak\GE14529-PA 1554 GE14529-PA 438..811 168..539 567 37 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1229..1773 137..667 566 30.9 Plus
Dyak\GE14529-PA 1554 GE14529-PA 73..419 323..673 550 39 Plus
Dyak\GE25396-PA 1755 GE25396-PA 264..848 157..673 526 29.7 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1277..1782 160..643 513 31.6 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1278..1712 227..671 425 31.2 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1390..1794 161..589 379 29.8 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1454..1794 156..523 270 29.3 Plus
Dyak\GE14529-PA 1554 GE14529-PA 73..258 488..677 230 33.7 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1242..1484 454..677 211 31.3 Plus
Dyak\GE10505-PA 2117 GE10505-PA 1649..1794 151..296 160 32.5 Plus

RE55168.hyp Sequence

Translation from 499 to 2592

> RE55168.hyp
MAQFVTHIQPTLMEASQGHVPHHHGHQVGVQHSSHLPHSGHNMPSPPTHN
HHHAHGHGHHTSSGGHHGGAGGHSQKQAAHHSTTSGHAAKGQHHSPPSRI
HSPPTEHHPDHVGHYEYFQHQHEQIFHHEGANGGASHKQQTHHHPNKHEH
CPTGHQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHL
ASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHN
ASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVA
MQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDV
TSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGK
TNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAK
TKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHV
RVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT
ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTD
IIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK
DMYTALHIAAKEGQDEVKDLIAKKITDHIDTVYLMQLFWIRHQEFFI*

RE55168.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
Ank2-PE 697 CG34416-PE 1..697 1..697 3684 100 Plus
Ank2-PK 4264 CG34416-PK 1..667 1..667 3524 100 Plus
Ank2-PR 4496 CG34416-PR 1..667 1..667 3524 100 Plus
Ank2-PW 1309 CG42734-PW 1..667 1..667 3524 100 Plus
Ank2-PV 4373 CG42734-PV 1..667 1..667 3524 100 Plus
Ank2-PK 4264 CG34416-PK 355..902 161..671 887 36.1 Plus
Ank2-PR 4496 CG34416-PR 355..902 161..671 887 36.1 Plus
Ank2-PW 1309 CG42734-PW 355..902 161..671 887 36.1 Plus
Ank2-PK 4264 CG34416-PK 420..944 160..681 864 38.6 Plus
Ank2-PR 4496 CG34416-PR 420..944 160..681 864 38.6 Plus
Ank2-PW 1309 CG42734-PW 420..944 160..681 864 38.6 Plus
Ank2-PK 4264 CG34416-PK 329..838 168..673 838 36.3 Plus
Ank2-PR 4496 CG34416-PR 329..838 168..673 838 36.3 Plus
Ank2-PW 1309 CG42734-PW 329..838 168..673 838 36.3 Plus
Ank2-PK 4264 CG34416-PK 160..541 292..673 565 36.3 Plus
Ank2-PR 4496 CG34416-PR 160..541 292..673 565 36.3 Plus
Ank2-PW 1309 CG42734-PW 160..541 292..673 565 36.3 Plus
Ank2-PK 4264 CG34416-PK 168..512 329..677 524 34.7 Plus
Ank2-PR 4496 CG34416-PR 168..512 329..677 524 34.7 Plus
Ank2-PW 1309 CG42734-PW 168..512 329..677 524 34.7 Plus
Ank2-PK 4264 CG34416-PK 758..1003 135..369 249 27.3 Plus
Ank2-PR 4496 CG34416-PR 758..1003 135..369 249 27.3 Plus
Ank2-PK 4264 CG34416-PK 745..925 155..331 247 32 Plus
Ank2-PR 4496 CG34416-PR 745..925 155..331 247 32 Plus
Ank2-PW 1309 CG42734-PW 745..925 155..331 247 32 Plus
Ank2-PW 1309 CG42734-PW 758..932 135..309 239 32 Plus
Ank2-PK 4264 CG34416-PK 160..317 519..676 213 31 Plus
Ank2-PR 4496 CG34416-PR 160..317 519..676 213 31 Plus
Ank2-PW 1309 CG42734-PW 160..317 519..676 213 31 Plus