Clone RE55494 Report

Search the DGRC for RE55494

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:554
Well:94
Vector:pFlc-1
Associated Gene/Transcriptcav-RE
Protein status:RE55494.pep: gold
Sequenced Size:1289

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
cav-RE 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE55494.complete Sequence

1289 bp assembled on 2010-12-09

GenBank Submission: BT125833.1

> RE55494.complete
AGTGTTCTGATAAAGTGTGAGACAACGTTTGTTTGTAAAAAGAACTACTC
AAATGGGATTTCAGTCAAAACAAAACAAGAGCACATCACACACAAGACGC
ACACATACACACAAGACGCACACGCACACAGATGGTCAAAGAGGTTAATA
TGTCGGGGACGCAAATGTCTGCCTTCCTGAGAAAGTATCTAGCCGACGAG
GACAAAAAAATTCGTGCGCAATTCAAAGAAAGCGATCCTAACAACAAATT
GATTCTATGGATGCACGAAAAAACGAGAATAACCGAGGAGGACTTGGCAC
GCCCATACACCGAGGACGAGGTAAAGGAGCTTTGTCTACGCACCAAAGTG
AAGGTTGATATGACCGCTTGGAATTGTCTGTGGGAAGCCAAAAAGAGGTT
TGAAGCAAAAGGACGTTTTGTGAACAAGTCTGAGAGATTCATCAACCGAA
TGTATATGAAAGCGGTGCGCAGAAAGATGGTCCAACCGTATCCGGAGGAG
TTTGTGGCCCAGCGAAGAGAAATAGTTGCAGCCGAGACTAAGAAGCAGAA
CATCAGCCGATTGGATAGATGGCAAAAGAAAAAGAGTCAAAACCTATCAG
CACCAGAATCCTCTCCAGACGCTCATGCATCTTCTAATGACGCGGTGCAG
AGCCACGAGGACCAAGCAAACACAAATCTTAGTTCACTGTCTCAAATGAA
CTTTCAAGTGGAAGCGATGGCTCCGCCAGGCGTGTCGTCATCTGATCTTA
GCGGCATCGGAGACGATGAGGACGAACAGCAGCAGTCAGGATTTCAGGAT
GAGAACATCAACCGTCCAGAGACAGAGATTAATGAGAATTCGGTGAGATG
TGATCCAATTAATTTAGGAAGGATGCGGACTGGATGTATAAATTCGCAAG
CAAATAACAGTTTCCGGAATACGGAGTCTGATCCGGACTACTATATGTTT
GGCACCCAATTGAGCACATTAGTACGACCCACGTCGACTCAAGAGCCTGA
CGATCAGGTAAACTGTCCAGAGACAGAGATGAATGAGAGCTGGGTAAGGT
GTGATCAAATTAATTCGGAAAGCTTGTCGATTGGACCGTCAATTGATTCG
GAAGGAACTATCACTTTTCAAAATACAGAATCTGAGCCGATCGACGTCAC
CTCAATAGCCTGATGTCCATATATTAAACTATATAAAGTTCTTCATTTAT
TGGTGTTAATTAATTAAAAACATGTAATCCCTAAAAATGTTATAAAATGT
ATAATAAAAATCTTAATTAAAATAAAAAAAAAAAAAAAA

RE55494.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20045879..20046877 275..1273 4995 100 Plus
chr3R 27901430 chr3R 20044955..20045099 1..145 725 100 Plus
chr3R 27901430 chr3R 20045681..20045818 138..275 675 99.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
cav-RE 1032 CG6219-PE 1..1032 132..1163 5160 100 Plus
cav-RA 1038 CG6219-PA 19..1038 144..1163 5100 100 Plus
cav-RB 1014 CG6219-PB 1..1014 150..1163 5070 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
cav-RE 1776 CG6219-RE 509..1776 1..1268 6340 100 Plus
cav-RB 1226 CG6219-RB 96..1226 138..1268 5640 99.9 Plus
cav-RA 1520 CG6219-RA 396..1520 144..1268 5625 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
cav-PE 343 CG6219-PE 1..343 132..1160 1786 100 Plus
cav-PA 345 CG6219-PA 7..345 144..1160 1767 100 Plus
cav-PB 337 CG6219-PB 1..337 150..1160 1757 100 Plus
cav-PD 337 CG6219-PD 1..337 150..1160 1757 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24222535..24223534 275..1274 5000 100 Plus
3R 32079331 3R 24221611..24221755 1..145 725 100 Plus
3R 32079331 3R 24222337..24222474 138..275 675 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23963366..23964365 275..1274 5000 100 Plus
3R 31820162 3R 23962442..23962586 1..145 725 100 Plus
3R 31820162 3R 23963168..23963305 138..275 675 99.2 Plus
Blast to na_te.dros performed on 2014-11-27 16:34:41 has no hits.

RE55494.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:57 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20045880..20046833 276..1229 100 <- Plus
chr3R 20045685..20045818 142..275 100 -> Plus
chr3R 20044955..20045035 1..81 100 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-10 09:34:24 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 1..1032 132..1163 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:34:36 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 1..1032 132..1163 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:57 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 1..1032 132..1163 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-10 09:34:24 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 470..1737 1..1268 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:34:36 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 509..1776 1..1268 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:57 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
cav-RE 509..1776 1..1268 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:57 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24222536..24223533 276..1273 100   Plus
3R 24222343..24222474 144..275 100 -> Plus
3R 24221611..24221753 1..143 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:34:36 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20048258..20049255 276..1273 100   Plus
arm_3R 20048065..20048196 144..275 100 -> Plus
arm_3R 20047333..20047475 1..143 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:36 Download gff for RE55494.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23963367..23964364 276..1273 100   Plus
3R 23963174..23963305 144..275 100 -> Plus
3R 23962442..23962584 1..143 100 -> Plus

RE55494.pep Sequence

Translation from 131 to 1162

> RE55494.pep
MVKEVNMSGTQMSAFLRKYLADEDKKIRAQFKESDPNNKLILWMHEKTRI
TEEDLARPYTEDEVKELCLRTKVKVDMTAWNCLWEAKKRFEAKGRFVNKS
ERFINRMYMKAVRRKMVQPYPEEFVAQRREIVAAETKKQNISRLDRWQKK
KSQNLSAPESSPDAHASSNDAVQSHEDQANTNLSSLSQMNFQVEAMAPPG
VSSSDLSGIGDDEDEQQQSGFQDENINRPETEINENSVRCDPINLGRMRT
GCINSQANNSFRNTESDPDYYMFGTQLSTLVRPTSTQEPDDQVNCPETEM
NESWVRCDQINSESLSIGPSIDSEGTITFQNTESEPIDVTSIA*

RE55494.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16116-PA 313 GF16116-PA 29..311 42..289 347 34.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11268-PA 328 GG11268-PA 1..328 7..343 1227 73.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18668-PA 216 GH18668-PA 1..78 77..154 208 48.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
cav-PE 343 CG6219-PE 1..343 1..343 1786 100 Plus
cav-PA 345 CG6219-PA 7..345 5..343 1767 100 Plus
cav-PB 337 CG6219-PB 1..337 7..343 1757 100 Plus
cav-PD 337 CG6219-PD 1..337 7..343 1757 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24179-PA 301 GI24179-PA 5..147 12..153 324 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23417-PA 282 GL23417-PA 1..279 7..288 359 35.4 Plus
Dper\GL14051-PA 186 GL14051-PA 1..159 7..166 264 36.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27250-PA 283 GA27250-PA 1..280 7..288 361 36.3 Plus
Dpse\GA26940-PA 186 GA26940-PA 1..159 7..166 275 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26573-PA 336 GM26573-PA 1..336 7..343 1607 88.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\cav-PA 336 GD21077-PA 1..336 7..343 1600 88.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14215-PA 301 GJ14215-PA 1..295 7..289 364 34.7 Plus
Dvir\GJ17001-PA 390 GJ17001-PA 9..203 12..207 213 31.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24325-PA 255 GK24325-PA 9..248 15..288 331 35.7 Plus
Dwil\GK11387-PA 271 GK11387-PA 19..213 28..233 330 38.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\anon-EST:fe1G5-PA 319 GE23460-PA 1..316 7..339 1164 67.4 Plus

RE55494.hyp Sequence

Translation from 131 to 1162

> RE55494.hyp
MVKEVNMSGTQMSAFLRKYLADEDKKIRAQFKESDPNNKLILWMHEKTRI
TEEDLARPYTEDEVKELCLRTKVKVDMTAWNCLWEAKKRFEAKGRFVNKS
ERFINRMYMKAVRRKMVQPYPEEFVAQRREIVAAETKKQNISRLDRWQKK
KSQNLSAPESSPDAHASSNDAVQSHEDQANTNLSSLSQMNFQVEAMAPPG
VSSSDLSGIGDDEDEQQQSGFQDENINRPETEINENSVRCDPINLGRMRT
GCINSQANNSFRNTESDPDYYMFGTQLSTLVRPTSTQEPDDQVNCPETEM
NESWVRCDQINSESLSIGPSIDSEGTITFQNTESEPIDVTSIA*

RE55494.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
cav-PE 343 CG6219-PE 1..343 1..343 1786 100 Plus
cav-PA 345 CG6219-PA 7..345 5..343 1767 100 Plus
cav-PB 337 CG6219-PB 1..337 7..343 1757 100 Plus
cav-PD 337 CG6219-PD 1..337 7..343 1757 100 Plus