Clone RE55560 Report

Search the DGRC for RE55560

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:555
Well:60
Vector:pFlc-1
Associated Gene/TranscriptCG11398-RA
Protein status:RE55560.pep: gold
Preliminary Size:990
Sequenced Size:1473

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11398 2001-12-14 Blastp of sequenced clone
CG11398 2002-01-01 Sim4 clustering to Release 2
CG11398 2003-01-01 Sim4 clustering to Release 3
CG11398 2008-04-29 Release 5.5 accounting
CG11398 2008-08-15 Release 5.9 accounting
CG11398 2008-12-18 5.12 accounting

Clone Sequence Records

RE55560.complete Sequence

1473 bp (1473 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071491

> RE55560.complete
ATGTGAAAATCAAAACAACATAAACTAATGTGTTTTAATTTGATTATTCT
CAAATGACTGAAGTACAATATAAAGAGGCCGAGATCTTGGCTCTACTACC
ACATACATATGAGGATGAGGAGCTGTCCTTAAACACAGAAGAGCTACAGT
TCGAGGAACTCAATGAGAGAAGCCAGCACCAGCAAGGCGGATCTCCGTCC
TTCGTCTGCAGACGCTGTCCAGCGCTATTCCTCACCAGGGAGGAGTTGGC
CGCCCATCGGCCCACACACCGATACCAGGGTGGACAGCAAACGCCCGCGT
CGGAGCATGCCTGCGACGCGTGTGGAAGGGTCTTCCAAAAGCACAACGCC
CTTGTGGATCACATGAATGCCCACAACGACGTGCGGAACTATCCGTGTCC
CGAGTGTCCGGCGCGCTTTGTGCAGCGCAGCAATAGGGAGTGTCACCTGA
AGAACGTTCATCGGAAGGTGTACCTGCACTCCTGTCCAGAACCGGGCTGC
AAGAAGCGTTTCCAGCAGAGGCGGGAGTGTGATCAGCATGTGAAGACGGT
CCACCAGAATGAGCGGAACCTCGTTTGCGACACCTGCAGTGCCCGCTTCA
GCCATCCTGTAAATTATAGAAAGCACTTGGCGTCCCATGGCTCCGCGAAG
AGCTACGGCTGTCCGATCTGTGGAAAGCTCTTCGGACGGCCCGAAAACAG
GGATGTTCATCTCTTCGTCCATAGTATCTGTAAGGCCTATATATGCTCCG
TCTGCGGAGCAGATTATATGCGGCGCAATCAGTTGATACGCCATGGCTTG
GCCAGTGGCCACCACAACGATCCGATTGTCCGCCAAAAACCGCAGTTTAG
TCCGGCCCTTGCTGCGAAGAATCGAAGCCAGAGAAGCGCAATAGACGAGT
CCCAGGACGAGGAGCTCCAATGGCTGAAAGGAGTTGACGCCCTCGACAGC
GCAGGATACCTGGAGAATTCACAATTTTCGAACACCGGCAAGATGACTGC
CATATTTGCAGAGGACGAAAACGAAAGCGAGTTATTCAATTGAATATGCA
TTGAGTAAGAAGTACCAGCAGTGTGGTATTGACCATCTAGGTGCTTAATC
AGCATACTAAGTAGGAACAGCTTAGTTCGAATGAAAAAACGAATGTAATT
GTAAATATGAAAACTGAACAATTAGGTCATAATAGTTAGCAATATTTACT
TAGATATCTATACTGCATTATATGTAGATGTACATATGTATCTATTGTAC
GGAAAGAGTCGAAAACTGAAAAATTGAATCTACAGACTTGGCTTTGGCAG
AAAACGCCATTAATTAATGAATGATAACATGCAAAAATGATTACCGCATG
CAAAACATGAACCGGAGACGTCGGTCAAAAAGTAACAACACAACAAAGAA
ATGAATGAAAAGTGAATGTCGCTGCTGCTCTTGCACTTTAATAAAAAATG
TGAAACGAAAAAAAAAAAAAAAA

RE55560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398.a 2328 CG11398.a 58..1517 1..1460 7255 99.7 Plus
CG11398-RA 1838 CG11398-RA 72..1531 1..1460 7255 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1107505..1108771 1455..189 6320 99.9 Minus
chrX 22417052 chrX 1108920..1109109 190..1 935 99.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-RD 990 CG11398-PD 1..990 54..1043 4950 100 Plus
CG11398-RA 990 CG11398-PA 1..990 54..1043 4950 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:03:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-RD 3018 CG11398-RD 26..1480 1..1455 7245 99.9 Plus
CG11398-RA 1487 CG11398-RA 26..1480 1..1455 7245 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-PD 329 CG11398-PD 1..329 54..1040 1798 100 Plus
CG11398-PA 329 CG11398-PA 1..329 54..1040 1798 100 Plus
CG15269-PA 587 CG15269-PA 297..485 198..794 269 29.9 Plus
Meics-PB 571 CG8474-PB 284..483 189..821 265 28.9 Plus
Meics-PA 583 CG8474-PA 296..495 189..821 265 28.9 Plus
CG15269-PA 587 CG15269-PA 286..463 279..809 234 33.9 Plus
Meics-PB 571 CG8474-PB 340..563 189..794 186 23.3 Plus
Meics-PB 571 CG8474-PB 410..571 150..650 156 30.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:44:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1213522..1214793 1460..189 6330 99.8 Minus
X 23542271 X 1214942..1215131 190..1 935 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1221620..1222891 1460..189 6330 99.8 Minus
X 23527363 X 1223040..1223229 190..1 935 99.4 Minus
Blast to na_te.dros performed on 2014-11-26 18:44:04 has no hits.

RE55560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 20:57:51 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1108921..1109109 1..189 99   Minus
chrX 1107503..1108770 190..1457 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:24:15 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..990 54..1043 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:41 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..990 54..1043 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:27:50 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..990 54..1043 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:00 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..990 54..1043 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:57:51 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..990 54..1043 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:21 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..1457 1..1457 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:41 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 58..1514 1..1457 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:27:50 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 26..1482 1..1457 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:01 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..1457 1..1457 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:57:51 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 26..1482 1..1457 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 20:57:51 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
X 1214943..1215131 1..189 99   Minus
X 1213525..1214792 190..1457 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:27:50 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1108976..1109164 1..189 99   Minus
arm_X 1107558..1108825 190..1457 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:48 Download gff for RE55560.complete
Subject Subject Range Query Range Percent Splice Strand
X 1223041..1223229 1..189 99   Minus
X 1221623..1222890 190..1457 99 <- Minus

RE55560.pep Sequence

Translation from 53 to 1042

> RE55560.pep
MTEVQYKEAEILALLPHTYEDEELSLNTEELQFEELNERSQHQQGGSPSF
VCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNAL
VDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCK
KRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKS
YGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRHGLA
SGHHNDPIVRQKPQFSPALAAKNRSQRSAIDESQDEELQWLKGVDALDSA
GYLENSQFSNTGKMTAIFAEDENESELFN*

RE55560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22028-PA 370 GF22028-PA 107..360 48..295 702 55.3 Plus
Dana\GF14340-PA 593 GF14340-PA 304..504 49..231 241 32.4 Plus
Dana\GF10403-PA 578 GF10403-PA 225..423 43..247 226 29.3 Plus
Dana\GF15824-PA 738 GF15824-PA 345..567 45..280 215 25.3 Plus
Dana\GF19706-PA 454 GF19706-PA 149..306 86..247 213 32.1 Plus
Dana\GF10403-PA 578 GF10403-PA 289..481 46..249 207 28.8 Plus
Dana\GF14340-PA 593 GF14340-PA 304..470 84..252 195 34.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12716-PA 338 GG12716-PA 1..338 1..329 1386 79.1 Plus
Dere\GG25148-PA 606 GG25148-PA 314..502 49..247 235 29.9 Plus
Dere\GG13746-PA 574 GG13746-PA 226..421 45..247 229 28.6 Plus
Dere\GG13746-PA 574 GG13746-PA 287..486 46..256 218 28.9 Plus
Dere\GG19296-PA 465 GG19296-PA 261..426 43..247 213 29.7 Plus
Dere\GG24566-PA 617 GG24566-PA 325..482 86..247 210 32.1 Plus
Dere\GG25148-PA 606 GG25148-PA 314..480 84..252 193 34.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11965-PA 281 GH11965-PA 83..272 83..274 376 40.6 Plus
Dgri\GH10919-PA 579 GH10919-PA 311..486 47..231 237 33 Plus
Dgri\GH10919-PA 579 GH10919-PA 286..474 49..247 223 28.9 Plus
Dgri\GH10862-PA 748 GH10862-PA 391..548 86..247 213 32.1 Plus
Dgri\GH25019-PA 701 GH25019-PA 380..537 86..247 212 32.1 Plus
Dgri\GH10804-PA 902 GH10804-PA 314..483 46..224 211 31.3 Plus
Dgri\GH10919-PA 579 GH10919-PA 286..452 84..252 195 34.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-PD 329 CG11398-PD 1..329 1..329 1798 100 Plus
CG11398-PA 329 CG11398-PA 1..329 1..329 1798 100 Plus
Meics-PB 571 CG8474-PB 223..418 45..247 274 28.6 Plus
Meics-PA 583 CG8474-PA 235..430 45..247 274 28.6 Plus
CG15269-PA 587 CG15269-PA 297..485 49..247 269 29.9 Plus
Meics-PB 571 CG8474-PB 284..483 46..256 265 28.9 Plus
Meics-PA 583 CG8474-PA 296..495 46..256 265 28.9 Plus
Meics-PB 571 CG8474-PB 340..563 46..247 186 23.3 Plus
Meics-PA 583 CG8474-PA 352..575 46..247 186 23.3 Plus
Meics-PB 571 CG8474-PB 410..571 33..199 156 30.1 Plus
Meics-PA 583 CG8474-PA 422..583 33..199 156 30.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15387-PA 412 GI15387-PA 207..401 76..272 397 41.1 Plus
Dmoj\GI13302-PA 606 GI13302-PA 308..508 49..231 239 31.9 Plus
Dmoj\GI17300-PA 323 GI17300-PA 57..281 25..257 214 27 Plus
Dmoj\GI13715-PA 641 GI13715-PA 332..489 86..247 212 32.1 Plus
Dmoj\GI23506-PA 777 GI23506-PA 352..563 45..266 210 25.1 Plus
Dmoj\GI13302-PA 606 GI13302-PA 308..474 84..252 196 34.3 Plus
Dmoj\GI17300-PA 323 GI17300-PA 82..251 113..287 158 29.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14397-PA 331 GL14397-PA 90..316 50..276 508 46.3 Plus
Dper\GL26031-PA 597 GL26031-PA 313..513 49..231 237 31.9 Plus
Dper\GL15688-PA 533 GL15688-PA 194..385 47..247 212 28.9 Plus
Dper\GL18461-PA 642 GL18461-PA 343..500 86..247 212 32.1 Plus
Dper\GL19065-PA 851 GL19065-PA 293..462 46..224 206 30.7 Plus
Dper\GL15688-PA 533 GL15688-PA 251..450 46..256 198 27 Plus
Dper\GL26031-PA 597 GL26031-PA 313..479 84..252 194 34.3 Plus
Dper\GL15688-PA 533 GL15688-PA 302..466 41..240 169 26 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10975-PA 331 GA10975-PA 90..316 50..276 512 46.7 Plus
Dpse\GA13615-PA 599 GA13615-PA 315..515 49..231 236 31.9 Plus
Dpse\GA16381-PA 649 GA16381-PA 350..507 86..247 213 32.1 Plus
Dpse\GA15080-PA 848 GA15080-PA 294..463 46..224 206 30.7 Plus
Dpse\GA20696-PA 436 GA20696-PA 238..398 52..223 203 30.6 Plus
Dpse\GA13615-PA 599 GA13615-PA 315..481 84..252 194 34.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18992-PA 223 GM18992-PA 1..218 1..218 1075 91.7 Plus
Dsec\GM15938-PA 643 GM15938-PA 353..541 49..247 236 29.9 Plus
Dsec\GM24571-PA 575 GM24571-PA 231..422 49..247 231 28.6 Plus
Dsec\GM24571-PA 575 GM24571-PA 288..487 46..256 224 28.9 Plus
Dsec\GM16579-PA 611 GM16579-PA 319..476 86..247 210 32.1 Plus
Dsec\GM18603-PA 838 GM18603-PA 291..460 46..224 210 30.7 Plus
Dsec\GM15938-PA 643 GM15938-PA 342..519 76..252 195 33.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23994-PA 592 GD23994-PA 302..490 49..247 236 29.9 Plus
Dsim\GD12643-PA 575 GD12643-PA 231..422 49..247 231 28.6 Plus
Dsim\GD12643-PA 575 GD12643-PA 288..487 46..256 224 28.9 Plus
Dsim\GD22883-PA 620 GD22883-PA 319..476 86..247 209 32.1 Plus
Dsim\GD23387-PA 839 GD23387-PA 292..461 46..224 209 30.7 Plus
Dsim\GD21902-PA 477 GD21902-PA 276..471 50..247 207 27 Plus
Dsim\GD23994-PA 592 GD23994-PA 291..468 76..252 195 33.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16809-PA 376 GJ16809-PA 181..365 86..272 387 42.2 Plus
Dvir\GJ11932-PA 596 GJ11932-PA 306..506 49..231 236 31.9 Plus
Dvir\GJ19651-PA 708 GJ19651-PA 336..493 86..247 212 32.1 Plus
Dvir\GJ20712-PA 735 GJ20712-PA 332..544 45..268 206 25.8 Plus
Dvir\GJ15680-PA 297 GJ15680-PA 55..280 24..249 204 26.1 Plus
Dvir\GJ11932-PA 596 GJ11932-PA 296..472 76..252 197 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25635-PA 369 GK25635-PA 74..297 85..308 493 44.1 Plus
Dwil\GK18315-PA 593 GK18315-PA 335..510 47..231 238 33 Plus
Dwil\GK18315-PA 593 GK18315-PA 310..498 49..247 227 28.9 Plus
Dwil\GK24816-PA 633 GK24816-PA 330..487 86..247 213 32.1 Plus
Dwil\GK14726-PA 913 GK14726-PA 327..496 46..224 202 30.7 Plus
Dwil\GK18315-PA 593 GK18315-PA 299..476 76..252 201 34.4 Plus
Dwil\GK21835-PA 277 GK21835-PA 12..179 47..223 198 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16541-PA 323 GE16541-PA 1..323 1..329 1320 78 Plus
Dyak\GE20043-PA 573 GE20043-PA 226..421 45..247 239 29.1 Plus
Dyak\GE20880-PA 596 GE20880-PA 305..505 49..231 235 31.4 Plus
Dyak\GE20043-PA 573 GE20043-PA 287..486 46..256 219 28.4 Plus
Dyak\GE18294-PA 346 GE18294-PA 147..340 45..249 212 28.8 Plus
Dyak\GE25878-PA 354 GE25878-PA 139..348 32..249 212 27.1 Plus
Dyak\GE20880-PA 596 GE20880-PA 279..471 60..252 199 33.3 Plus

RE55560.hyp Sequence

Translation from 53 to 1042

> RE55560.hyp
MTEVQYKEAEILALLPHTYEDEELSLNTEELQFEELNERSQHQQGGSPSF
VCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNAL
VDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCK
KRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKS
YGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRHGLA
SGHHNDPIVRQKPQFSPALAAKNRSQRSAIDESQDEELQWLKGVDALDSA
GYLENSQFSNTGKMTAIFAEDENESELFN*

RE55560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-PD 329 CG11398-PD 1..329 1..329 1798 100 Plus
CG11398-PA 329 CG11398-PA 1..329 1..329 1798 100 Plus
Meics-PB 571 CG8474-PB 223..418 45..247 274 28.6 Plus
Meics-PA 583 CG8474-PA 235..430 45..247 274 28.6 Plus
CG15269-PA 587 CG15269-PA 297..485 49..247 269 29.9 Plus
Meics-PB 571 CG8474-PB 284..483 46..256 265 28.9 Plus
Meics-PA 583 CG8474-PA 296..495 46..256 265 28.9 Plus
Meics-PB 571 CG8474-PB 340..563 46..247 186 23.3 Plus
Meics-PA 583 CG8474-PA 352..575 46..247 186 23.3 Plus
Meics-PB 571 CG8474-PB 410..571 33..199 156 30.1 Plus
Meics-PA 583 CG8474-PA 422..583 33..199 156 30.1 Plus