Clone RE56801 Report

Search the DGRC for RE56801

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:568
Well:1
Vector:pFlc-1
Associated Gene/TranscriptTfIIFbeta-RA
Protein status:RE56801.pep: gold
Preliminary Size:1262
Sequenced Size:1103

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6538 2001-12-14 Blastp of sequenced clone
CG6538 2002-01-01 Sim4 clustering to Release 2
CG6538 2003-01-01 Sim4 clustering to Release 3
TfIIFbeta 2008-04-29 Release 5.5 accounting
TfIIFbeta 2008-08-15 Release 5.9 accounting
TfIIFbeta 2008-12-18 5.12 accounting

Clone Sequence Records

RE56801.complete Sequence

1103 bp (1103 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071514

> RE56801.complete
AACAACAACAAGCAAAGCCGAAAACGGTACAAGTGGCTTTGCAAATTCGT
TTTTAATAATTTAAAGCAAACAGAATGTCGAAGGAGGATAAGGAAAAGAC
ACAGATCATCGACAAGGACCTGGACCTGTCCAATGCTGGGCGAGGCGTAT
GGCTGGTGAAGGTGCCCAAGTACATTGCCCAGAAATGGGAGAAGGCGCCG
ACGAACATGGACGTGGGCAAGCTCCGGATAAACAAGACACCTGGCCAAAA
GGCCCAGGTCTCGCTTTCCCTCACGCCCGCCGTTTTGGCTCTAGATCCCG
AGGAGAAAATACCCACCGAGCACATCCTGGACGTGTCGCAGGTCACCAAG
CAGACGCTCGGCGTATTCTCGCACATGGCACCGTCCGATGGCAAGGAGAA
CTCGACTACCTCGGCGGCACAGCCGGATAACGAAAAGTTGTATATGGAGG
GCAGGATTGTGCAAAAGCTAGAGTGCCGACCCATCGCCGACAACTGCTAC
ATGAAACTAAAGCTGGAGTCCATACGCAAGGCATCGGAACCACAGCGACG
TGTGCAGCCTATCGACAAAATCGTGCAGAACTTTAAGCCTGTAAAAGACC
ACGCACACAACATTGAATATCGGGAGCGAAAGAAGGCCGAGGGCAAGAAG
GCGCGCGACGACAAGAATGCCGTGATGGATATGCTCTTCCACGCATTCGA
GAAGCATCAATACTATAACATCAAGGATCTGGTCAAGATCACCAACCAGC
CGATTAGCTACCTGAAGGAGATTCTCAAGGATGTCTGCGATTACAATATG
AAGAACCCGCACAAGAACATGTGGGAGCTCAAGAAAGAATATCGCCACTA
CAAGACTGAAGAGAAGAAAGAGGAGGAGCACAAGTCAGGCAGCAGCGACT
CGGAGTAGCATTGGGAGAATCGCCGACTTACTTTCATTAAAACACATTAA
GTAATTGCATGGTTCCGTTTTATTCCTTAAGAACTACACGTTATACTTAC
GAAAAAAACATTATATCTTAAAATGATTGTAAATAGACACTAGCTTGCAC
TCTGGTAAATACATACGTATATATACACTTTATCCTCAAAAAAAAAAAAA
AAA

RE56801.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-RA 1452 TfIIFbeta-RA 212..1297 1..1086 5430 100 Plus
Cap-H2-RF 4149 Cap-H2-RF 4004..4149 1086..941 730 100 Minus
Cap-H2.d 4158 Cap-H2.d 4013..4158 1086..941 730 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6592682..6593292 611..1 3040 99.8 Minus
chr3R 27901430 chr3R 6592142..6592616 1086..612 2375 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-RA 834 CG6538-PA 1..834 75..908 4170 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:04:47 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-RA 1118 CG6538-RA 32..1117 1..1086 5430 100 Plus
Cap-H2-RF 3976 CG14685-RF 3843..3976 1086..953 670 100 Minus
Cap-H2-RE 4015 CG14685-RE 3882..4015 1086..953 670 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-PA 277 CG6538-PA 1..277 75..905 1250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10767163..10767773 611..1 3055 100 Minus
3R 32079331 3R 10766623..10767097 1086..612 2375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10507994..10508604 611..1 3055 100 Minus
3R 31820162 3R 10507454..10507928 1086..612 2375 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:52:26 has no hits.

RE56801.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:31:05 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6592682..6593292 1..611 99   Minus
chr3R 6592141..6592616 612..1087 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:25:10 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 1..834 75..908 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:25 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 1..834 75..908 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:38:02 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 1..834 75..908 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:42 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 1..834 75..908 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:31:05 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 1..834 75..908 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:25 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 174..1259 1..1087 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:25 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 174..1259 1..1087 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:38:02 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 32..1117 1..1087 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:42 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 174..1259 1..1087 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:05 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 32..1117 1..1087 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:31:05 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10767163..10767773 1..611 100   Minus
3R 10766622..10767097 612..1087 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:38:02 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6592885..6593495 1..611 100   Minus
arm_3R 6592344..6592819 612..1087 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:38 Download gff for RE56801.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10507994..10508604 1..611 100   Minus
3R 10507453..10507928 612..1087 99 <- Minus

RE56801.pep Sequence

Translation from 74 to 907

> RE56801.pep
MSKEDKEKTQIIDKDLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKL
RINKTPGQKAQVSLSLTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSH
MAPSDGKENSTTSAAQPDNEKLYMEGRIVQKLECRPIADNCYMKLKLESI
RKASEPQRRVQPIDKIVQNFKPVKDHAHNIEYRERKKAEGKKARDDKNAV
MDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDYNMKNPHKNMW
ELKKEYRHYKTEEKKEEEHKSGSSDSE*

RE56801.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17437-PA 281 GF17437-PA 1..281 1..277 1316 92.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17267-PA 277 GG17267-PA 1..277 1..277 1468 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14638-PA 287 GH14638-PA 1..287 1..277 1344 89.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-PA 277 CG6538-PA 1..277 1..277 1453 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23671-PA 288 GI23671-PA 1..288 1..277 1313 87.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12621-PA 282 GL12621-PA 1..282 1..277 1322 91.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19669-PA 282 GA19669-PA 1..282 1..277 1322 91.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26151-PA 277 GM26151-PA 1..277 1..277 1455 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20705-PA 277 GD20705-PA 1..277 1..277 1468 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23231-PA 286 GJ23231-PA 1..286 1..277 1336 88.8 Plus
Dvir\GJ21374-PA 247 GJ21374-PA 1..243 1..263 499 40.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13842-PA 280 GK13842-PA 1..260 1..259 1240 91.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24669-PA 277 GE24669-PA 1..277 1..277 1461 98.2 Plus

RE56801.hyp Sequence

Translation from 74 to 907

> RE56801.hyp
MSKEDKEKTQIIDKDLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKL
RINKTPGQKAQVSLSLTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSH
MAPSDGKENSTTSAAQPDNEKLYMEGRIVQKLECRPIADNCYMKLKLESI
RKASEPQRRVQPIDKIVQNFKPVKDHAHNIEYRERKKAEGKKARDDKNAV
MDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDYNMKNPHKNMW
ELKKEYRHYKTEEKKEEEHKSGSSDSE*

RE56801.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-PA 277 CG6538-PA 1..277 1..277 1453 100 Plus