Clone RE58063 Report

Search the DGRC for RE58063

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:580
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG17359-RA
Protein status:RE58063.pep: gold
Preliminary Size:1020
Sequenced Size:1361

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17359 2001-12-14 Blastp of sequenced clone
CG17359 2002-01-01 Sim4 clustering to Release 2
CG17359 2003-01-01 Sim4 clustering to Release 3
CG17359 2008-04-29 Release 5.5 accounting
CG17359 2008-08-15 Release 5.9 accounting
CG17359 2008-12-18 5.12 accounting

Clone Sequence Records

RE58063.complete Sequence

1361 bp (1361 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071545

> RE58063.complete
AGTTGCATTTTGTTGATATTGTATATTTTTGATCCTGCCTACGAAACTCT
GGAGCTCGGCCACGATGGACATTTCGCAAATGTGCCGCGTTTGCAGGGAC
GAATCCGACTGCCTGTTGGATATATATACAGAGCCATATGCCTCCTCCAA
TCGGGTCCAGGAGCAGGAGCCGGTCTTGGCCACAATGCTGAGGGAATGCA
GCGGATGCAGCGTGCATAAGGAGGACGGAATGCCGCAGTTCATCTGCGTG
GAGTGTGCGGAGGCCGTAAGAAATGCCTATCGGCTAAGACGGCAATGCCG
AAAGAGCCATCAGTACTTTGAACAGCTGCGTCTGATGATGAAGGAGCTGG
ACGATATAGAGTATTGCCTGAATATAGGGGATAACATAGAACCACAGATG
CCGGTCTCGGTAATGGAAGCTGGTAAAACGCCGGAGACATCCGAACCTCT
TTTAGTTGAGCTTGTGCAGGTTAAGTACATGCCTCCAGAGCCGAAGCCAA
TATCTTCTCCTCTTCCAGACAACAATGAGCATAAGCTCGCGCAAAGTTAT
TCTCCAGCAAAGACGCCACACAATAAGTCCAAGAGGAGGGCGAGATCCTA
CTCGGACAATGACTCATGGAGCCCGGATAGTGAGCTTGAACACGAAGATG
ATGATAAAATCTGGAACGCCTCAAAACGGGGCAAACCGAAAAGGGTTCCC
GGACCATATCGGTGCAAGCTCTGCACACAGTCGTTCACCCAAAAACAAAA
CCTAGAGATTCACATGCGCATACATACTGGCGAGCGACCCTACAAGTGCT
CCCTATGTCCGCGATCCTTTGCCCAGAAGGGCAACCTGCAGAGCCACACA
CGTTGTCACACCGGCGAGCGTCCCTTCGGTTGTCCGAACTGCCCCAAGCG
CTTCCGGCAAGTTGGGCAACTGCAAGTCCACACCCGGACTCATACTGGCG
AACAGCCGTTCAAATGTTCCAAATGTCAGCAAAGCTTCAAGCAACTAAAC
GGCCTACAAAAACACATGTCAGCACACACGCGAGGGAAGCGACGGACGAG
CAGCCAAGAAACAAAAAGAAATAAGTTTAAATAGTTAAGATTTGTTAAAG
GTATTTTCATATATTGAATGTCCATATAATAATTTCTTGTTTGAAATCGA
CAAAGCTAGTAATCGCAACCAAAGTGAGAAAGCTGCCTAAAAACTGTTGT
GAATCGATCCGATTATCATTTCTTTATTATCTTATTGTCAATATGAGAAC
ATGAAATTGTTTTTAAAACTACACTCCATATGTACTTTCATTATTAGTCG
CTAACTTGTTTCTACTTTAAAAATATATCGAACTTATTTTTAAAACGAAA
AAAAAAAAAAA

RE58063.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG17359-RA 1356 CG17359-RA 1..1348 1..1348 6725 99.9 Plus
CG17361-RA 868 CG17361-RA 707..867 1348..1188 805 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 18:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13987960..13989306 1347..1 6660 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 18:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG17359-RA 1020 CG17359-PA 1..1020 65..1084 5100 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:05:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 18:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG17359-RA 1352 CG17359-RA 6..1352 1..1347 6720 99.9 Plus
CG17361-RA 865 CG17361-RA 710..865 1347..1192 780 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 18:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG17359-PA 339 CG17359-PA 1..339 65..1081 1773 100 Plus
CG44002-PA 345 CG44002-PA 5..320 83..1069 376 26.6 Plus
Meics-PB 571 CG8474-PB 8..366 44..1027 353 25.7 Plus
Aef1-PB 308 CG5683-PB 183..294 704..1039 312 43.8 Plus
Aef1-PC 308 CG5683-PC 183..294 704..1039 312 43.8 Plus
Meics-PB 571 CG8474-PB 343..454 704..1039 293 42.9 Plus
Meics-PB 571 CG8474-PB 371..484 704..1045 279 40.4 Plus
Meics-PB 571 CG8474-PB 316..423 707..1030 268 42.6 Plus
Aef1-PB 308 CG5683-PB 211..296 704..961 236 43 Plus
Aef1-PB 308 CG5683-PB 181..266 782..1039 222 43 Plus
Meics-PB 571 CG8474-PB 427..571 704..1039 176 28.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 18:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13997899..13999246 1348..1 6725 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13990999..13992346 1348..1 6725 99.9 Minus
Blast to na_te.dros performed 2014-11-26 18:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 6120..6216 1163..1067 125 64.4 Minus

RE58063.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 20:58:11 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13987960..13989306 1..1347 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:26:06 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1020 65..1084 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:42 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1020 65..1084 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:28:20 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1020 65..1084 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:58 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1020 65..1084 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:58:11 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1020 65..1084 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:47 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1347 1..1347 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:41 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1347 1..1347 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:28:20 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 6..1352 1..1347 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:58 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 1..1347 1..1347 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:58:11 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
CG17359-RA 6..1352 1..1347 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 20:58:11 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13997900..13999246 1..1347 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:28:20 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13991000..13992346 1..1347 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:56 Download gff for RE58063.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13991000..13992346 1..1347 99   Minus

RE58063.pep Sequence

Translation from 64 to 1083

> RE58063.pep
MDISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSV
HKEDGMPQFICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEY
CLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPL
PDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDDDKIW
NASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPR
SFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFK
CSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQETKRNKFK*

RE58063.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20119-PA 304 GF20119-PA 1..286 1..295 470 37 Plus
Dana\GF18117-PA 609 GF18117-PA 377..550 148..322 307 36.5 Plus
Dana\GF10403-PA 578 GF10403-PA 9..399 3..321 302 27.4 Plus
Dana\GF20022-PA 182 GF20022-PA 37..145 214..322 297 49.5 Plus
Dana\GF20022-PA 182 GF20022-PA 9..117 214..322 295 47.7 Plus
Dana\GF11351-PA 278 GF11351-PA 46..156 215..325 292 46.8 Plus
Dana\GF20022-PA 182 GF20022-PA 65..181 214..330 289 45.3 Plus
Dana\GF18117-PA 609 GF18117-PA 470..577 214..321 281 43.5 Plus
Dana\GF10403-PA 578 GF10403-PA 376..489 214..327 277 41.2 Plus
Dana\GF10403-PA 578 GF10403-PA 348..456 214..322 275 42.2 Plus
Dana\GF20022-PA 182 GF20022-PA 1..89 234..322 253 50.6 Plus
Dana\GF10403-PA 578 GF10403-PA 323..428 217..322 235 39.6 Plus
Dana\GF10403-PA 578 GF10403-PA 432..544 214..321 229 41.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13743-PA 341 GG13743-PA 2..341 1..335 1215 69.4 Plus
Dere\GG24456-PA 348 GG24456-PA 5..336 7..318 349 29.8 Plus
Dere\GG13562-PA 298 GG13562-PA 3..296 4..321 333 28.1 Plus
Dere\GG25008-PA 615 GG25008-PA 298..555 38..323 333 31.2 Plus
Dere\GG25200-PA 413 GG25200-PA 4..254 2..322 316 30.7 Plus
Dere\GG25008-PA 615 GG25008-PA 178..300 214..332 310 49.6 Plus
Dere\GG25008-PA 615 GG25008-PA 506..612 214..320 277 46.7 Plus
Dere\GG25008-PA 615 GG25008-PA 149..261 211..326 261 46.6 Plus
Dere\GG25008-PA 615 GG25008-PA 365..505 188..326 221 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13049-PA 345 GH13049-PA 1..305 3..321 410 33.3 Plus
Dgri\GH13680-PA 384 GH13680-PA 1..299 3..326 390 32.4 Plus
Dgri\GH10681-PA 355 GH10681-PA 1..295 3..322 375 28.9 Plus
Dgri\GH17091-PA 444 GH17091-PA 1..403 3..322 356 27.4 Plus
Dgri\GH18569-PA 479 GH18569-PA 1..270 3..320 325 29.7 Plus
Dgri\GH13049-PA 345 GH13049-PA 226..334 214..322 307 52.3 Plus
Dgri\GH10681-PA 355 GH10681-PA 242..351 213..322 284 46.4 Plus
Dgri\GH13680-PA 384 GH13680-PA 273..379 215..321 282 47.7 Plus
Dgri\GH13680-PA 384 GH13680-PA 244..355 214..326 254 41.6 Plus
Dgri\GH17091-PA 444 GH17091-PA 293..431 214..322 239 35.3 Plus
Dgri\GH13049-PA 345 GH13049-PA 254..336 214..296 215 47 Plus
Dgri\GH13049-PA 345 GH13049-PA 166..253 238..326 167 39.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17359-PA 339 CG17359-PA 1..339 1..339 1853 100 Plus
CG44002-PA 345 CG44002-PA 5..320 7..335 379 26.9 Plus
Meics-PB 571 CG8474-PB 21..411 7..339 352 24.4 Plus
Meics-PA 583 CG8474-PA 21..423 7..339 344 24.4 Plus
gl-PB 557 CG7672-PB 392..547 167..325 320 37.1 Plus
Meics-PB 571 CG8474-PB 343..454 214..325 293 42.9 Plus
Meics-PA 583 CG8474-PA 355..466 214..325 293 42.9 Plus
Meics-PB 571 CG8474-PB 371..484 214..327 279 40.4 Plus
Meics-PA 583 CG8474-PA 383..496 214..327 279 40.4 Plus
Meics-PB 571 CG8474-PB 316..423 215..322 268 42.6 Plus
Meics-PA 583 CG8474-PA 328..435 215..322 268 42.6 Plus
Meics-PB 571 CG8474-PB 427..571 214..325 176 28.1 Plus
Meics-PA 583 CG8474-PA 439..583 214..325 176 28.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13598-PA 345 GI13598-PA 1..306 3..326 459 35.2 Plus
Dmoj\GI11127-PA 384 GI11127-PA 1..357 3..326 419 30.7 Plus
Dmoj\GI17965-PA 403 GI17965-PA 1..325 3..331 367 28.3 Plus
Dmoj\GI24263-PA 604 GI24263-PA 395..551 159..322 332 40.2 Plus
Dmoj\GI12025-PA 350 GI12025-PA 225..336 214..325 301 43.8 Plus
Dmoj\GI17965-PA 403 GI17965-PA 294..403 215..324 299 49.1 Plus
Dmoj\GI11127-PA 384 GI11127-PA 275..382 215..322 270 43.5 Plus
Dmoj\GI17965-PA 403 GI17965-PA 265..376 214..326 247 41.6 Plus
Dmoj\GI24263-PA 604 GI24263-PA 499..578 214..293 218 46.2 Plus
Dmoj\GI11127-PA 384 GI11127-PA 302..382 214..294 201 45.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17891-PA 464 GL17891-PA 11..345 1..326 528 38.6 Plus
Dper\GL20489-PA 360 GL20489-PA 1..300 3..322 398 31.4 Plus
Dper\GL26275-PA 880 GL26275-PA 272..578 3..325 385 31.5 Plus
Dper\GL20486-PA 339 GL20486-PA 1..305 3..339 352 31.1 Plus
Dper\GL26891-PA 236 GL26891-PA 115..227 214..326 342 52.2 Plus
Dper\GL17891-PA 464 GL17891-PA 318..427 214..323 329 51.8 Plus
Dper\GL26275-PA 880 GL26275-PA 495..605 214..324 312 51.4 Plus
Dper\GL20489-PA 360 GL20489-PA 220..336 214..330 306 47 Plus
Dper\GL26275-PA 880 GL26275-PA 148..258 215..326 296 52.7 Plus
Dper\GL26275-PA 880 GL26275-PA 2..275 35..314 295 29 Plus
Dper\GL20489-PA 360 GL20489-PA 248..360 214..326 292 48.7 Plus
Dper\GL26275-PA 880 GL26275-PA 702..861 176..322 287 38.8 Plus
Dper\GL26275-PA 880 GL26275-PA 411..522 214..326 281 46.9 Plus
Dper\GL26275-PA 880 GL26275-PA 119..230 214..325 277 44.6 Plus
Dper\GL26275-PA 880 GL26275-PA 666..808 213..334 275 40.6 Plus
Dper\GL26275-PA 880 GL26275-PA 63..202 181..326 272 42.3 Plus
Dper\GL26275-PA 880 GL26275-PA 579..708 214..339 250 42.3 Plus
Dper\GL26275-PA 880 GL26275-PA 600..730 205..333 239 38.9 Plus
Dper\GL26275-PA 880 GL26275-PA 624..768 199..322 236 35.9 Plus
Dper\GL20486-PA 339 GL20486-PA 239..318 215..294 177 42.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28526-PA 464 GA28526-PA 11..345 1..326 509 37.1 Plus
Dpse\GA25545-PB 362 GA25545-PB 1..302 3..322 393 32.1 Plus
Dpse\GA25534-PA 412 GA25534-PA 1..281 3..322 361 31.3 Plus
Dpse\GA25541-PA 242 GA25541-PA 74..185 214..326 347 56.6 Plus
Dpse\GA26117-PA 423 GA26117-PA 12..282 29..326 345 29.5 Plus
Dpse\GA28526-PA 464 GA28526-PA 318..427 214..323 322 51.8 Plus
Dpse\GA25541-PA 242 GA25541-PA 130..239 214..323 318 52.7 Plus
Dpse\GA25541-PA 242 GA25541-PA 102..213 214..326 314 49.6 Plus
Dpse\GA25541-PA 242 GA25541-PA 38..157 206..326 308 48.8 Plus
Dpse\GA25545-PB 362 GA25545-PB 222..338 214..330 305 47 Plus
Dpse\GA25545-PB 362 GA25545-PB 250..362 214..326 292 48.7 Plus
Dpse\GA25534-PA 412 GA25534-PA 97..270 188..339 284 37.7 Plus
Dpse\GA25534-PA 412 GA25534-PA 285..393 214..322 248 45.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24566-PA 343 GM24566-PA 1..343 1..339 1505 85.8 Plus
Dsec\GM18478-PA 345 GM18478-PA 1..285 3..323 362 29.9 Plus
Dsec\GM18162-PA 418 GM18162-PA 9..328 32..322 332 27.8 Plus
Dsec\GM24571-PA 575 GM24571-PA 9..415 3..339 320 24.1 Plus
Dsec\GM18664-PA 413 GM18664-PA 4..254 2..322 319 30.7 Plus
Dsec\GM18162-PA 418 GM18162-PA 248..356 214..322 273 46.8 Plus
Dsec\GM18664-PA 413 GM18664-PA 174..277 214..317 232 39.4 Plus
Dsec\GM18162-PA 418 GM18162-PA 304..411 214..321 227 38.9 Plus
Dsec\GM18162-PA 418 GM18162-PA 276..387 214..326 226 39.8 Plus
Dsec\GM18162-PA 418 GM18162-PA 332..418 214..300 171 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12639-PA 127 GD12639-PA 1..114 1..115 566 93.9 Plus
Dsim\GD22772-PA 392 GD22772-PA 15..306 38..322 317 26.8 Plus
Dsim\GD24049-PA 413 GD24049-PA 4..254 2..322 317 30.7 Plus
Dsim\GD12643-PA 575 GD12643-PA 9..398 3..321 317 24.1 Plus
Dsim\GD22773-PA 325 GD22773-PA 15..311 38..318 308 29.5 Plus
Dsim\GD22772-PA 392 GD22772-PA 226..334 214..322 273 45.9 Plus
Dsim\GD12643-PA 575 GD12643-PA 347..458 214..325 271 42.9 Plus
Dsim\GD12643-PA 575 GD12643-PA 375..488 214..327 264 40.4 Plus
Dsim\GD12643-PA 575 GD12643-PA 320..427 215..322 246 42.6 Plus
Dsim\GD22772-PA 392 GD22772-PA 282..389 214..321 236 39.8 Plus
Dsim\GD24049-PA 413 GD24049-PA 174..277 214..317 232 39.4 Plus
Dsim\GD22772-PA 392 GD22772-PA 254..365 214..326 231 39.8 Plus
Dsim\GD12643-PA 575 GD12643-PA 431..575 214..325 152 28.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13935-PA 362 GJ13935-PA 1..296 3..331 383 30.6 Plus
Dvir\GJ16305-PA 405 GJ16305-PA 1..329 3..335 381 30.6 Plus
Dvir\GJ11368-PA 438 GJ11368-PA 1..360 3..322 377 29.9 Plus
Dvir\GJ18319-PA 411 GJ18319-PA 1..353 3..322 375 31.3 Plus
Dvir\GJ11511-PA 506 GJ11511-PA 1..333 3..318 374 30.6 Plus
Dvir\GJ13935-PA 362 GJ13935-PA 208..319 215..326 312 49.1 Plus
Dvir\GJ18319-PA 411 GJ18319-PA 274..381 215..322 292 45.4 Plus
Dvir\GJ16305-PA 405 GJ16305-PA 294..401 215..322 285 48.1 Plus
Dvir\GJ13935-PA 362 GJ13935-PA 235..347 214..325 273 46 Plus
Dvir\GJ11368-PA 438 GJ11368-PA 308..418 214..324 272 42.3 Plus
Dvir\GJ18319-PA 411 GJ18319-PA 302..409 215..322 267 44.4 Plus
Dvir\GJ16305-PA 405 GJ16305-PA 265..376 214..326 252 41.6 Plus
Dvir\GJ11368-PA 438 GJ11368-PA 335..416 213..294 223 42.7 Plus
Dvir\GJ18319-PA 411 GJ18319-PA 329..409 214..294 203 48.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18485-PA 331 GK18485-PA 1..295 6..320 342 31.1 Plus
Dwil\GK13252-PA 418 GK13252-PA 12..345 6..325 336 27.8 Plus
Dwil\GK11495-PA 620 GK11495-PA 429..563 191..322 306 40.7 Plus
Dwil\GK20477-PA 451 GK20477-PA 184..295 214..325 301 44.6 Plus
Dwil\GK21835-PA 277 GK21835-PA 45..155 215..325 291 46.8 Plus
Dwil\GK11495-PA 620 GK11495-PA 483..590 214..321 282 43.5 Plus
Dwil\GK13252-PA 418 GK13252-PA 263..370 215..322 237 38.9 Plus
Dwil\GK13252-PA 418 GK13252-PA 290..392 214..317 228 40.4 Plus
Dwil\GK20477-PA 451 GK20477-PA 212..297 214..299 225 43 Plus
Dwil\GK18485-PA 331 GK18485-PA 162..275 214..327 224 39.5 Plus
Dwil\GK18485-PA 331 GK18485-PA 104..245 184..326 171 30.1 Plus
Dwil\GK13252-PA 418 GK13252-PA 317..398 213..295 158 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20038-PA 338 GE20038-PA 2..336 1..334 1207 70.9 Plus
Dyak\GE18295-PA 346 GE18295-PA 1..317 3..322 370 29.1 Plus
Dyak\GE14934-PA 352 GE14934-PA 5..340 7..318 337 28.1 Plus
Dyak\GE18294-PA 346 GE18294-PA 1..316 3..323 326 27.8 Plus
Dyak\GE25969-PA 382 GE25969-PA 1..344 3..322 324 27.5 Plus
Dyak\GE18294-PA 346 GE18294-PA 235..345 214..324 289 48.6 Plus
Dyak\GE18295-PA 346 GE18295-PA 118..208 235..326 156 34.8 Plus

RE58063.hyp Sequence

Translation from 64 to 1083

> RE58063.hyp
MDISQMCRVCRDESDCLLDIYTEPYASSNRVQEQEPVLATMLRECSGCSV
HKEDGMPQFICVECAEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEY
CLNIGDNIEPQMPVSVMEAGKTPETSEPLLVELVQVKYMPPEPKPISSPL
PDNNEHKLAQSYSPAKTPHNKSKRRARSYSDNDSWSPDSELEHEDDDKIW
NASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPR
SFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQVHTRTHTGEQPFK
CSKCQQSFKQLNGLQKHMSAHTRGKRRTSSQETKRNKFK*

RE58063.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG17359-PA 339 CG17359-PA 1..339 1..339 1853 100 Plus
CG44002-PA 345 CG44002-PA 5..320 7..335 379 26.9 Plus
Meics-PB 571 CG8474-PB 21..411 7..339 352 24.4 Plus
Meics-PA 583 CG8474-PA 21..423 7..339 344 24.4 Plus
gl-PB 557 CG7672-PB 392..547 167..325 320 37.1 Plus
Meics-PB 571 CG8474-PB 343..454 214..325 293 42.9 Plus
Meics-PA 583 CG8474-PA 355..466 214..325 293 42.9 Plus
Meics-PB 571 CG8474-PB 371..484 214..327 279 40.4 Plus
Meics-PA 583 CG8474-PA 383..496 214..327 279 40.4 Plus
Meics-PB 571 CG8474-PB 316..423 215..322 268 42.6 Plus
Meics-PA 583 CG8474-PA 328..435 215..322 268 42.6 Plus
Meics-PB 571 CG8474-PB 427..571 214..325 176 28.1 Plus
Meics-PA 583 CG8474-PA 439..583 214..325 176 28.1 Plus