Clone RE60512 Report

Search the DGRC for RE60512

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:605
Well:12
Vector:pFlc-1
Associated Gene/Transcripthkb-RA
Protein status:RE60512.pep: gold
Preliminary Size:1014
Sequenced Size:1580

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9768 2002-01-01 Sim4 clustering to Release 2
CG9768 2002-04-26 Blastp of sequenced clone
CG9768 2003-01-01 Sim4 clustering to Release 3
hkb 2008-04-29 Release 5.5 accounting
hkb 2008-08-15 Release 5.9 accounting
hkb 2008-12-18 5.12 accounting

Clone Sequence Records

RE60512.complete Sequence

1580 bp (1580 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113527

> RE60512.complete
AGTTGGAGTCGAGATCTCGCAGCACACACACAGCTCCGCACAACCAAATC
AAGTCCAAAATCATAATCACAAGTGTTCCATCCAAGTGATTTAGTGTCGC
GAGAGAGCAATTTAGACCTTCCATTAAAACTACTGCAAAATGTCGACGAT
TAACCTGCATCCCCCGCAAACCTACTCGCGACTTTTCCGACCCTGGGATA
CTCAGCGCCAGGCGGCGACCTCGGCGGCACCCAGGACAGTGAAGCAGGAG
CCGGAGGCGATTACCATCAAGACGGAGCTGGCCAGCAGCAGTTTCGGCCA
CGACTGCGACGGAGACTTCTCCTCCGCATCCTCCTCTGCGTCAAGCAGCA
GCAACAGCAGCAAGTCCTGCTACGAGGAGGCCCTGAACCACAGCAGCTAC
ACCCGCACTTCCACCCCGCTGCTGGACGCCGCCCCGCACCCCGTCTTTTC
ACACCCGCAGTCGTCGCCGTTGGACACGCACGCCGCCGCCACCGCATCCT
TGGCTCCGCCAAACCAGCACGCTCCATTCCTGTCGGCCGCCAGCGATCTC
TACTACGCTGCCGCCGCCGCAGCAGCCGCTGCTGCCTCCACGCCCACTGC
CGTCCCGGGCTTCGGCATGGACCCGTTCACTATGGGCCTGATGGAGCAAG
AGTACGCCCGCGTGATGGCCGAGGACGCACAGTTAAAGGCGCTCAACAGC
CGCAAGCAGCGGCCGAAGAAGTTCAAGTGCCCCAACTGCGACGTGGCCTT
CTCCAACAACGGCCAGCTGAAGGGCCACATCCGCATCCACACCGGCGAAC
GCCCATTTAAGTGCGACGTGAACACATGCGGCAAGACCTTCACCCGCAAT
GAGGAACTGACGCGTCACAAGCGAATCCACACCGGACTGCGGCCGTATCC
TTGCAGTGCCTGCGGAAAGAAGTTTGGCCGACGCGACCACTTAAAGAAGC
ACATGAAGACGCACATGCCGCAGGAGCGCCAGCTGGGCCCGTCCATCTTC
GTGCCCATGTACTCATACCTTTATGGCTACTGAGAGGGAAATCCTGGCGA
GCTTTCCCCTTGCCACGCGACCCTGCATTCCAGCGATCTGTAAAGCGCTT
GCACGCTTTAAACAAGCATTACCGAACCGAATCCAACGAAACGAAACTTA
ACGCCAGCAAAAACTGCCTAGCCAATCGTGGACAGAACTACCTCAGCCGT
ACCTGGCGCAATGTGGCGCACTCACCAAACCCAATCTTTGGACCTCGACG
ATATATGCAAATATTGAGATATTTATTTTTTAACGCGTATTTACACTTCC
AGCTACGTGACTGGTTATGATATTCGGCACATGTGTAAATAATCCCTAAG
TGATCCTTCCTCATATGCTAAGCGATTAAGAAATTTAAGAGATGCCCGGA
TTTACGTCTAAGTTATACTAAAGCTGATACTTTAACAGTTTTATAAGCTG
ATCGTGGTTACCAGATACATACGATTTATACACAAAATTATACGATCATG
GTTATATCTGAGAGTTGAATTATACGATTTATGTTTACAACACAAAATAC
ACAAGAAAAACCGAAAAAAAAAAAAAAAAA

RE60512.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
hkb.a 2079 hkb.a 403..1965 1..1563 7800 99.9 Plus
hkb-RA 1783 hkb-RA 107..1669 1..1563 7800 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 171568..172362 795..1 3960 99.9 Minus
chr3R 27901430 chr3R 170735..171504 1563..794 3850 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-RA 894 CG9768-PA 1..894 140..1033 4470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:07:28 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:51:56
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-RA 1567 CG9768-RA 5..1567 1..1563 7800 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-PA 297 CG9768-PA 1..297 140..1030 1391 100 Plus
CG3065-PC 378 CG3065-PC 73..186 680..1015 249 43 Plus
CG3065-PA 400 CG3065-PA 95..208 680..1015 249 43 Plus
CG3065-PB 400 CG3065-PB 95..208 680..1015 249 43 Plus
cbt-PC 347 CG4427-PC 168..264 680..964 245 45.4 Plus
CG3065-PC 378 CG3065-PC 321..375 797..967 164 50.9 Plus
CG3065-PA 400 CG3065-PA 343..397 797..967 164 50.9 Plus
CG3065-PB 400 CG3065-PB 343..397 797..967 164 50.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4345848..4346642 795..1 3960 99.9 Minus
3R 32079331 3R 4345015..4345784 1563..794 3850 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4086679..4087473 795..1 3960 99.8 Minus
3R 31820162 3R 4085846..4086615 1563..794 3850 100 Minus
Blast to na_te.dros performed 2014-11-27 09:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6862 283..408 169 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2301..2529 197..415 131 54.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2358..2448 324..415 115 59.8 Plus

RE60512.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:52:04 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 171569..172362 1..794 93   Minus
chr3R 170735..171503 795..1563 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:28:02 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 1..894 140..1033 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:55:22 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 1..894 140..1033 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:46:13 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 1..894 140..1033 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:48:16 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 1..894 140..1033 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:52:04 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 1..894 140..1033 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:34:34 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 9..1571 1..1563 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:55:22 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 9..1571 1..1563 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:46:13 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 5..1567 1..1563 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:48:16 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 9..1571 1..1563 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:52:04 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 5..1567 1..1563 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:52:04 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4345849..4346642 1..794 99   Minus
3R 4345015..4345783 795..1563 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:46:13 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 171571..172364 1..794 99   Minus
arm_3R 170737..171505 795..1563 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:20:31 Download gff for RE60512.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4086680..4087473 1..794 99   Minus
3R 4085846..4086614 795..1563 100 <- Minus

RE60512.pep Sequence

Translation from 139 to 1032

> RE60512.pep
MSTINLHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASS
SFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPH
PVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAAS
TPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNC
DVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGL
RPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYGY*

RE60512.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 21:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16814-PA 300 GF16814-PA 1..300 1..297 1091 76.5 Plus
Dana\cbt-PA 425 GF24751-PA 180..345 99..275 258 37 Plus
Dana\GF22531-PA 689 GF22531-PA 276..451 123..280 247 34.8 Plus
Dana\GF19068-PA 769 GF19068-PA 654..764 158..276 244 43 Plus
Dana\GF12885-PA 389 GF12885-PA 116..204 193..282 235 48.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 21:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11643-PA 300 GG11643-PA 1..300 1..297 1308 90.4 Plus
Dere\GG18322-PA 668 GG18322-PA 249..430 117..280 264 35.3 Plus
Dere\cbt-PA 428 GG24646-PA 211..345 128..275 256 38.7 Plus
Dere\GG19480-PA 837 GG19480-PA 722..832 158..276 244 43 Plus
Dere\GG18323-PA 714 GG18323-PA 375..473 177..275 243 45.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 21:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18734-PA 288 GH18734-PA 1..288 1..297 1012 75.7 Plus
Dgri\GH18919-PA 1018 GH18919-PA 788..874 191..275 251 49.4 Plus
Dgri\GH11800-PA 754 GH11800-PA 343..423 198..280 249 53 Plus
Dgri\GH17835-PA 841 GH17835-PA 726..836 158..276 247 43 Plus
Dgri\GH11802-PA 689 GH11802-PA 373..471 177..275 245 45.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 21:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-PA 297 CG9768-PA 1..297 1..297 1582 100 Plus
btd-PA 644 CG12653-PA 151..418 61..280 272 31.5 Plus
cbt-PC 347 CG4427-PC 31..264 40..275 270 31.2 Plus
cbt-PB 347 CG4427-PB 31..264 40..275 270 31.2 Plus
cbt-PA 428 CG4427-PA 112..345 40..275 270 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 21:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22886-PA 291 GI22886-PA 1..291 1..297 1033 75.6 Plus
Dmoj\GI23419-PA 1030 GI23419-PA 805..891 191..275 249 49.4 Plus
Dmoj\cbt-PA 455 GI18030-PA 270..356 191..275 246 48.3 Plus
Dmoj\GI21748-PA 807 GI21748-PA 692..802 158..276 246 43 Plus
Dmoj\GI15983-PA 675 GI15983-PA 368..466 177..275 245 45.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 21:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12325-PA 292 GL12325-PA 1..292 1..297 1024 72 Plus
Dper\GL24133-PA 1000 GL24133-PA 761..849 187..275 252 49.4 Plus
Dper\GL16371-PA 725 GL16371-PA 253..436 115..280 251 34.9 Plus
Dper\GL16372-PA 703 GL16372-PA 376..474 177..275 243 45.5 Plus
Dper\GL11644-PA 385 GL11644-PA 114..212 193..289 236 45.5 Plus
Dper\GL16372-PA 703 GL16372-PA 370..451 197..280 151 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 21:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22020-PA 292 GA22020-PA 1..292 1..297 1024 72 Plus
Dpse\GA22354-PA 726 GA22354-PA 251..434 115..280 251 34.9 Plus
Dpse\GA19045-PC 999 GA19045-PC 760..848 187..275 251 49.4 Plus
Dpse\cbt-PA 450 GA18176-PA 220..360 121..275 247 38.2 Plus
Dpse\GA10742-PA 808 GA10742-PA 693..803 158..276 245 43 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 21:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10707-PA 297 GM10707-PA 1..297 1..297 1435 97.6 Plus
Dsec\GM11382-PA 648 GM11382-PA 244..423 119..280 263 35.2 Plus
Dsec\cbt-PA 428 GM16664-PA 211..345 128..275 254 39.3 Plus
Dsec\GM17579-PA 800 GM17579-PA 685..795 158..276 245 43 Plus
Dsec\GM11386-PA 510 GM11386-PA 174..272 177..275 242 45.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 21:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19684-PA 297 GD19684-PA 1..297 1..297 1565 98.3 Plus
Dsim\cbt-PA 428 GD22954-PA 211..345 128..275 253 41.3 Plus
Dsim\GD19200-PA 1019 GD19200-PA 866..951 193..278 242 46.6 Plus
Dsim\GD18309-PA 969 GD18309-PA 748..823 200..275 239 52.6 Plus
Dsim\GD11817-PA 399 GD11817-PA 16..205 90..289 235 33.5 Plus
Dsim\GD11817-PA 399 GD11817-PA 342..396 220..276 161 50.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 21:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14181-PA 295 GJ14181-PA 1..295 1..297 1014 76.3 Plus
Dvir\GJ19127-PA 796 GJ19127-PA 681..791 158..276 248 43 Plus
Dvir\GJ23272-PA 1185 GJ23272-PA 1017..1103 190..278 247 47.3 Plus
Dvir\GJ14523-PA 474 GJ14523-PA 257..334 198..275 243 52.6 Plus
Dvir\GJ19699-PA 383 GJ19699-PA 113..202 193..280 240 48.9 Plus
Dvir\GJ19699-PA 383 GJ19699-PA 326..380 220..276 171 50.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 21:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13762-PA 284 GK13762-PA 1..284 1..297 1007 74.2 Plus
Dwil\GK25352-PA 741 GK25352-PA 327..407 198..280 247 53 Plus
Dwil\GK11712-PA 961 GK11712-PA 717..803 191..275 247 49.4 Plus
Dwil\GK25088-PA 794 GK25088-PA 679..789 158..276 245 43 Plus
Dwil\cbt-PA 444 GK24649-PA 265..351 191..275 242 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 21:56:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25358-PA 295 GE25358-PA 1..295 1..297 1334 92.6 Plus
Dyak\GE17806-PA 654 GE17806-PA 241..422 117..280 263 35.3 Plus
Dyak\cbt-PA 428 GE16084-PA 211..345 128..275 259 42 Plus
Dyak\GE16133-PA 821 GE16133-PA 706..816 158..276 245 43 Plus
Dyak\GE17808-PA 712 GE17808-PA 370..468 177..275 243 45.5 Plus

RE60512.hyp Sequence

Translation from 139 to 1032

> RE60512.hyp
MSTINLHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASS
SFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPH
PVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAAS
TPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNC
DVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGL
RPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYGY*

RE60512.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-PA 297 CG9768-PA 1..297 1..297 1582 100 Plus
btd-PA 644 CG12653-PA 151..418 61..280 272 31.5 Plus
cbt-PC 347 CG4427-PC 31..264 40..275 270 31.2 Plus
cbt-PB 347 CG4427-PB 31..264 40..275 270 31.2 Plus
cbt-PA 428 CG4427-PA 112..345 40..275 270 31.2 Plus