Clone RE63353 Report

Search the DGRC for RE63353

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:633
Well:53
Vector:pFlc-1
Associated Gene/Transcriptflr-RB
Protein status:RE63353.pep: gold
Sequenced Size:2225

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10724-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE63353.complete Sequence

2225 bp assembled on 2009-09-22

GenBank Submission: BT099796.1

> RE63353.complete
AGTCATGAATCCGATCCCACTCCGAATGTGATACGTAGAGAGGGGGATGA
GTCAACAGGCGAAAAACGAAAACATCTACGCAACTCTGCCGCGCACCCAA
CGCGGCCAACCCATCGTTTTGGGTGCCGATCCCAAGGGCAAGAACTTCCT
GTACACCAATGGAAACTCTGTGATCATCCGGAACATCGAGAATCCAGCCA
TTGCCGATGTCTACACGGAGCACTCGTGTGCAGTGAACGTGGCCAAGTAC
TCGCCCAGCGGATTTTATATTGCATCTGGTGACGCCTCCGGCAAGATTCG
CATTTGGGACACGGTCAACAAGGAGCACCTGCTTAAAAATGAGTTCCAGC
CCATTGCAGGACCCATCAAGGATATTAGCTGGTCGCCAGACAATCAGCGC
ATCGTTGCCGTGGGTGAAGGACGCGAACGTTTCGGTCATGTCTTTATGTC
TGAAACCGGCACGTCTGTGGGCGAGATCAGTGGCCAGTCCAAGTCTATTA
ACTCGGCGGACTTCCGGCCAGCCAGGCCATTCCGCATTGTTACGGGCAGC
GAAGACAATACTATCGCCGTGTTCGAGGGACCCCCGTTCAAGTTCAAGAT
GACCAAGCAGGATCACTCTCGCTTCGTCCAGGCTGTGCGCTACTCGCCCG
ATGGCAAATTCTTCGCCTCCGCCGGCTTTGATGGCAAAGTCTTTCTGTAC
GATGGCACCAGCTCTGAACTGGTGGGCGAATTTGGATCTCCTGCCCACAA
GGGCGGCGTTTACGCATTGGCCTGGAAACCAGACAGCACCCAACTGCTAA
CCTGCTCCGGCGACAAGACGTGCCGCCTTTGGACAGTGGAGTCGCGCGAG
CTGGTTAGCGAGTTTGTGATGGGCACCACTGTGGACGACCAGCAGGTGTC
CTGCTTGTGGCAAGGAGACAACCTAATCACCGTCTCGCTTTCGGGCGTGA
TCACCTACCTCAATGTGGCGGATCCCTCGAAACCGCTGCGTGTGGTGAAG
GGCCACAATAAGCCCATCACCGTGCTGGGACTGAGCGATGACCGCAGCAC
CATATACACGGGTAGCCACGATGGCGTGGTGACCAACTGGAACTCGGGCA
GCGGCACCAACGATCGCATCACGGGCACTGGACACGGAAACCAGATCAAC
GGCATTGCCGCCTGGGGTGACTTTGTCTATACCTGTGGCATCGACGACAG
CCTACGCCAGTTCAGCGTGGAGGGCAACTCCTACACGGACTATGTGGTGA
AGCTTAACTGCCAGCCACGTGGCTTGGCCATTTTGCGCAACGAGAACATC
ATTGCACTTGCTTGCATCAAAGAGTTGACTCTCGTGCAGGACCAGAAGAA
GATCTTTTCGCTGCCCATTAAGTACGAGGCTAGCTCGATTGCCGTTAATG
CGGACACTTCCGATGTTGCTGTCGGCGGGGATGACCAAAAGTTGCACATC
TACACCCTGAAGGGCGGAGTATTGGAGCCCAAAGTGGAGCTGGATCACTT
GGGAGCTGTCACGGATGTTTCTTATTCGCCGGACTTGAAGTATTTGGTGG
CTTGCGATGCCCATCGCAAGGTGGTGCTCTACTCAGTGGAGGAGTACAAG
CCTGCACACAACAAGGAGTGGGGCTTCCACAGTGCTCGCGTAAATACGGT
GGCCTGGTCGCCCAACTCGCTGCTGGTTGCTAGTGGATCATTGGACACTA
CTATCATTATCTGGTCCGTGGCCAATCCGGCCAAACATACTATCATCAAG
AATGCCCATCCGCAGTCGCAAATCACTCGGTTGGTCTGGCTGGACAATAA
CACTGTGATCTCCACCGGACAGGACTGCAACACCAAGGTGTGGCACGTGG
AAAACATTTAAATGCGCCGGCCGTGAAGCATATTTTTATACTTATCCAGG
GAGAGCAGCCAGCAGCGCCCTGGCTTCATTTCATTTAAGTGCAACAGTTT
ACATTTAGATATTTATGTCTTTTTCCCCGCCCTCCCCGCACACCTCATGT
CATGTCTTTAATTTTAAGCCAAAAGTGTTTGCTAATCATCATATCATGGA
TATTCAACTACTTTGCCCCACTATCATTTTCGTATGTGTTTTTCGAACAA
TTTTTATACTACTGGAACTACGAACTACGAAAGGAAACACAAAGATATGT
GAAGTACGCCAGCGTACATAAATTATTGTATTATGAAATGAAATATACTA
GTTTTTGCATAAAAAAAAAAAAAAA

RE63353.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
flr-RB 2433 flr-RB 181..2391 1..2211 11040 99.9 Plus
flr-RA 2412 flr-RA 222..2370 63..2211 10715 99.9 Plus
flr.b 2712 flr.b 222..2370 63..2211 10715 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13404878..13405938 540..1600 5275 99.8 Plus
chr3L 24539361 chr3L 13406213..13406671 1752..2210 2265 99.6 Plus
chr3L 24539361 chr3L 13404554..13404819 281..546 1330 100 Plus
chr3L 24539361 chr3L 13405992..13406145 1598..1751 770 100 Plus
chr3L 24539361 chr3L 13403534..13403656 68..190 615 100 Plus
chr3L 24539361 chr3L 13404274..13404366 189..281 465 100 Plus
chr3L 24539361 chr3L 13403224..13403291 1..68 340 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
flr-RB 1815 CG10724-PB 1..1815 47..1861 9075 100 Plus
flr-RA 1827 CG10724-PA 29..1827 63..1861 8980 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:04 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
flr-RB 2210 CG10724-RB 1..2210 1..2210 11035 100 Plus
flr-RA 2275 CG10724-RA 128..2275 63..2210 10710 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
flr-PB 604 CG10724-PB 1..604 47..1858 3182 100 Plus
flr-PA 608 CG10724-PA 10..608 62..1858 3151 99.7 Plus
Nle-PA 488 CG2863-PA 117..486 482..1843 240 23.3 Plus
Poc1-PA 391 CG10191-PA 7..305 191..1114 238 23.3 Plus
Poc1-PB 403 CG10191-PB 7..305 191..1114 238 23.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13414660..13415720 540..1600 5290 99.9 Plus
3L 28110227 3L 13415995..13416454 1752..2211 2285 99.8 Plus
3L 28110227 3L 13414336..13414601 281..546 1330 100 Plus
3L 28110227 3L 13415774..13415927 1598..1751 770 100 Plus
3L 28110227 3L 13413316..13413438 68..190 615 100 Plus
3L 28110227 3L 13414056..13414148 189..281 465 100 Plus
3L 28110227 3L 13413006..13413073 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13407760..13408820 540..1600 5290 99.9 Plus
3L 28103327 3L 13409095..13409554 1752..2211 2285 99.7 Plus
3L 28103327 3L 13407436..13407701 281..546 1330 100 Plus
3L 28103327 3L 13408874..13409027 1598..1751 770 100 Plus
3L 28103327 3L 13406416..13406538 68..190 615 100 Plus
3L 28103327 3L 13407156..13407248 189..281 465 100 Plus
3L 28103327 3L 13406106..13406173 1..68 340 100 Plus
Blast to na_te.dros performed on 2014-11-27 09:09:03 has no hits.

RE63353.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:38:31 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13406213..13406671 1752..2210 99   Plus
chr3L 13405995..13406145 1601..1751 100 -> Plus
chr3L 13404884..13405938 546..1600 99 -> Plus
chr3L 13404555..13404818 282..545 100 -> Plus
chr3L 13404276..13404366 191..281 100 -> Plus
chr3L 13403535..13403656 69..190 100 -> Plus
chr3L 13403224..13403291 1..68 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:54 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
CG10724-RB 1..1815 47..1861 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:32:23 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 1..1815 47..1861 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:14:45 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 1..1815 47..1861 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:38:31 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 1..1815 47..1861 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-22 09:10:41 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
CG10724-RB 1..2210 1..2210 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:32:23 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 1..2210 1..2210 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:14:45 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 1..2210 1..2210 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:38:31 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
flr-RB 1..2210 1..2210 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:38:31 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13415995..13416453 1752..2210 99   Plus
3L 13415777..13415927 1601..1751 100 -> Plus
3L 13414666..13415720 546..1600 100 -> Plus
3L 13414337..13414600 282..545 100 -> Plus
3L 13414058..13414148 191..281 100 -> Plus
3L 13413317..13413438 69..190 100 -> Plus
3L 13413006..13413073 1..68 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:14:45 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13409095..13409553 1752..2210 99   Plus
arm_3L 13408877..13409027 1601..1751 100 -> Plus
arm_3L 13407766..13408820 546..1600 100 -> Plus
arm_3L 13407437..13407700 282..545 100 -> Plus
arm_3L 13407158..13407248 191..281 100 -> Plus
arm_3L 13406417..13406538 69..190 100 -> Plus
arm_3L 13406106..13406173 1..68 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:55 Download gff for RE63353.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13409095..13409553 1752..2210 99   Plus
3L 13408877..13409027 1601..1751 100 -> Plus
3L 13407766..13408820 546..1600 100 -> Plus
3L 13407437..13407700 282..545 100 -> Plus
3L 13407158..13407248 191..281 100 -> Plus
3L 13406417..13406538 69..190 100 -> Plus
3L 13406106..13406173 1..68 100 -> Plus

RE63353.pep Sequence

Translation from 46 to 1860

> RE63353.pep
MSQQAKNENIYATLPRTQRGQPIVLGADPKGKNFLYTNGNSVIIRNIENP
AIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNEF
QPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKS
INSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYS
PDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQL
LTCSGDKTCRLWTVESRELVSEFVMGTTVDDQQVSCLWQGDNLITVSLSG
VITYLNVADPSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNS
GSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYV
VKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSLPIKYEASSIAV
NADTSDVAVGGDDQKLHIYTLKGGVLEPKVELDHLGAVTDVSYSPDLKYL
VACDAHRKVVLYSVEEYKPAHNKEWGFHSARVNTVAWSPNSLLVASGSLD
TTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWH
VENI*

RE63353.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:28:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23482-PA 608 GF23482-PA 10..608 6..604 3123 97 Plus
Dana\GF10412-PA 403 GF10412-PA 5..305 47..356 218 22.5 Plus
Dana\GF14879-PA 489 GF14879-PA 116..487 144..599 217 23.6 Plus
Dana\GF22217-PA 361 GF22217-PA 27..268 13..262 182 24 Plus
Dana\GF20976-PA 358 GF20976-PA 65..357 55..348 180 24.7 Plus
Dana\GF22217-PA 361 GF22217-PA 60..230 179..353 164 25.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15640-PA 608 GG15640-PA 10..608 6..604 3183 99.2 Plus
Dere\GG13777-PA 390 GG13777-PA 5..305 47..356 228 23.2 Plus
Dere\GG24639-PA 488 GG24639-PA 115..486 144..599 220 23.8 Plus
Dere\GG21819-PA 343 GG21819-PA 43..212 179..353 186 30.5 Plus
Dere\GG17982-PA 358 GG17982-PA 69..357 59..348 180 24.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16896-PA 608 GH16896-PA 10..608 6..604 3040 93.5 Plus
Dgri\GH10505-PA 485 GH10505-PA 101..446 174..558 197 23.9 Plus
Dgri\GH14795-PA 404 GH14795-PA 6..306 47..356 196 20.6 Plus
Dgri\GH15383-PA 559 GH15383-PA 350..559 51..266 188 27.6 Plus
Dgri\GH22022-PA 358 GH22022-PA 10..223 135..353 186 26.6 Plus
Dgri\GH10505-PA 485 GH10505-PA 348..455 164..273 169 33.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
flr-PB 604 CG10724-PB 1..604 1..604 3182 100 Plus
flr-PA 608 CG10724-PA 10..608 6..604 3151 99.7 Plus
Nle-PA 488 CG2863-PA 117..486 146..599 240 23.3 Plus
Poc1-PA 391 CG10191-PA 7..305 49..356 238 23.3 Plus
Poc1-PB 403 CG10191-PB 7..305 49..356 238 23.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11513-PA 608 GI11513-PA 10..608 6..604 2993 92 Plus
Dmoj\GI18023-PA 485 GI18023-PA 115..446 144..558 226 24.5 Plus
Dmoj\GI11850-PA 402 GI11850-PA 2..302 47..356 202 22.2 Plus
Dmoj\GI19111-PA 373 GI19111-PA 39..234 156..352 190 27.9 Plus
Dmoj\GI14411-PA 356 GI14411-PA 44..355 41..348 180 24.5 Plus
Dmoj\GI18023-PA 485 GI18023-PA 250..455 59..273 173 26.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25444-PA 592 GL25444-PA 10..592 6..604 2967 93 Plus
Dper\GL15696-PA 413 GL15696-PA 5..305 47..356 234 22.8 Plus
Dper\GL21559-PA 413 GL21559-PA 5..305 47..356 228 22.5 Plus
Dper\GL25365-PA 413 GL25365-PA 5..305 47..356 222 22.2 Plus
Dper\GL19252-PA 482 GL19252-PA 109..481 144..557 219 23.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10524-PA 608 GA10524-PA 10..608 6..604 3083 95.7 Plus
Dpse\GA10144-PA 413 GA10144-PA 5..305 47..356 234 22.8 Plus
Dpse\GA26333-PB 299 GA26333-PB 5..299 47..350 224 22.3 Plus
Dpse\GA25887-PA 482 GA25887-PA 109..481 144..557 219 23.6 Plus
Dpse\GA10552-PA 356 GA10552-PA 67..355 59..348 181 24.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25418-PA 608 GM25418-PA 10..608 6..604 3190 99.5 Plus
Dsec\GM16656-PA 488 GM16656-PA 115..486 144..599 223 23.6 Plus
Dsec\GM24599-PA 389 GM24599-PA 5..305 47..356 217 23.2 Plus
Dsec\GM11205-PA 358 GM11205-PA 69..357 59..348 180 24.7 Plus
Dsec\GM19230-PA 361 GM19230-PA 71..268 59..262 176 26.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14448-PA 608 GD14448-PA 10..608 6..604 3190 99.5 Plus
Dsim\GD22949-PA 483 GD22949-PA 110..481 144..599 221 23.8 Plus
Dsim\GD12669-PA 389 GD12669-PA 5..305 47..356 214 23.2 Plus
Dsim\GD16125-PA 358 GD16125-PA 69..357 59..348 180 24.7 Plus
Dsim\GD16610-PA 361 GD16610-PA 71..268 59..262 176 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11768-PA 608 GJ11768-PA 10..608 6..604 3031 93.5 Plus
Dvir\GJ19693-PA 488 GJ19693-PA 115..486 144..599 215 24.2 Plus
Dvir\GJ22241-PA 373 GJ22241-PA 39..235 156..353 205 28.7 Plus
Dvir\GJ13548-PA 405 GJ13548-PA 2..302 47..356 201 20.9 Plus
Dvir\GJ19693-PA 488 GJ19693-PA 250..455 59..273 181 26.6 Plus
Dvir\GJ18759-PA 356 GJ18759-PA 44..355 41..348 181 24.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17082-PA 608 GK17082-PA 10..608 6..604 3035 93.5 Plus
Dwil\GK24428-PA 493 GK24428-PA 119..492 144..557 211 23.1 Plus
Dwil\GK10412-PA 414 GK10412-PA 7..305 49..356 201 22.3 Plus
Dwil\GK18046-PA 583 GK18046-PA 374..583 51..266 181 26.7 Plus
Dwil\GK19916-PA 356 GK19916-PA 67..355 59..348 179 24.7 Plus
Dwil\GK24428-PA 493 GK24428-PA 254..460 59..273 168 26.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21969-PA 608 GE21969-PA 10..608 6..604 3170 98.5 Plus
Dyak\GE16018-PA 481 GE16018-PA 108..479 144..599 221 23.8 Plus
Dyak\GE20071-PA 391 GE20071-PA 5..305 47..356 216 22.8 Plus
Dyak\GE11895-PA 343 GE11895-PA 43..212 179..353 182 29.9 Plus
Dyak\GE17476-PA 358 GE17476-PA 69..357 59..348 180 24.7 Plus

RE63353.hyp Sequence

Translation from 46 to 1860

> RE63353.hyp
MSQQAKNENIYATLPRTQRGQPIVLGADPKGKNFLYTNGNSVIIRNIENP
AIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKEHLLKNEF
QPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKS
INSADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYS
PDGKFFASAGFDGKVFLYDGTSSELVGEFGSPAHKGGVYALAWKPDSTQL
LTCSGDKTCRLWTVESRELVSEFVMGTTVDDQQVSCLWQGDNLITVSLSG
VITYLNVADPSKPLRVVKGHNKPITVLGLSDDRSTIYTGSHDGVVTNWNS
GSGTNDRITGTGHGNQINGIAAWGDFVYTCGIDDSLRQFSVEGNSYTDYV
VKLNCQPRGLAILRNENIIALACIKELTLVQDQKKIFSLPIKYEASSIAV
NADTSDVAVGGDDQKLHIYTLKGGVLEPKVELDHLGAVTDVSYSPDLKYL
VACDAHRKVVLYSVEEYKPAHNKEWGFHSARVNTVAWSPNSLLVASGSLD
TTIIIWSVANPAKHTIIKNAHPQSQITRLVWLDNNTVISTGQDCNTKVWH
VENI*

RE63353.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
flr-PB 604 CG10724-PB 1..604 1..604 3182 100 Plus
flr-PA 608 CG10724-PA 10..608 6..604 3151 99.7 Plus
Nle-PA 488 CG2863-PA 117..486 146..599 240 23.3 Plus
Poc1-PA 391 CG10191-PA 7..305 49..356 238 23.3 Plus
Poc1-PB 403 CG10191-PB 7..305 49..356 238 23.3 Plus