Clone RE64054 Report

Search the DGRC for RE64054

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:640
Well:54
Vector:pFlc-1
Associated Gene/Transcriptdac-RE
Protein status:RE64054.pep: validated not full length
Preliminary Size:4949
Sequenced Size:1997

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4952 2002-01-01 Sim4 clustering to Release 2
CG4952 2003-01-01 Sim4 clustering to Release 3
CG4952 2003-08-11 Blastp of sequenced clone
dac 2008-04-29 Release 5.5 accounting
dac 2008-08-15 Release 5.9 accounting
dac 2008-12-18 5.12 accounting

Clone Sequence Records

RE64054.complete Sequence

1997 bp (1997 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010231

> RE64054.complete
AATTTCTGAGTGACAATCCGTCGGTACGGTACTCGAAAACGGACACAGCT
CCGGTTTCCAAAATTCCAGTACGAAAACGGTTATTCGAACTCGATTAACA
CAAGCGGGCAATCGGAATAAATAACTTGAAATATTCAGAGTATATATTTC
ACAGCGAAATTCAAAAAGCAAAGTGCGCGAGTGTCTTGTGTCAGTGATGT
TGAGTTTATAAATTACTTTTAGACCTCCTTAAAGGTAAATCTATGTTCTA
TATCGAATTATTCAAATAAAGCTGACAATAGGTATATTTATGCAAATTGG
CAGTAAGGATCCAAATTAGCTTCATTGCCTTGTTTTTCCCAAAACTTAAT
TAAAGCAAAGTTTGCAAAGCAATAGTTCTGTTGATAAAGGATTATTTATG
GGGGGTATTAGAAGATAATCGGACTTTAAATGTCTGAAAGGAAACTTTTC
TATTTTCTGTTAGTTCTCTATGTTTCTTTGTAAGTAAAATGTTTGTTAGG
ATATTAATTTACAAAAAATATTTAGCAATATAAACTTGTAGCTACCATAT
AACTAACTAAACTGGCTCAAAAATAGATTTTAATAAATAGGAGCATAGCT
GAGCCTAATACAAATCCTAAATCGTTTGTAAATTTTTTGAAGGTCTGCAT
TTAAATTTGATGTTATAAAACTTACAGAAGTATTAAAAATGTAAAGCCAA
TAATAAGCGGATAGGAATATACGAGACACGCTCACTTAGAATTTGCATAT
AGAAGCCTAATAAATAATTAAAAATGAATTAAGAGTTCATTAATTATTTA
TCTTCCTCTCACCATCTATTTTCTATTTCTCCCTTACTTTGTGTCAAATT
TTTGTCACGATAGAAAAAACGTCAAATTAACGAATCGATTAAAAAGTAAA
TAAACAAAAGTGTCGGCCATGATGAAGTATGGATTCTGTGACAAGTGAAC
AGAGTGAAAATAACAACAATAAAGCGGGCGCAATAAATAACAATATTAAT
AGTGGTATTGAAAGAGCCGCGGGCAATATGAACACCACCGCCATGTTGAT
GCATCACCAGCAGCAGCAGCAGGCAGCCGCAGCAGCGGCAGCCGCAGCAG
CCCAGCAGCAACAGCAGCAGCACAATGGACGCGACGGTAGCAACAGTTCG
CGTGGAGCCAACGAGGATCGTCCAAATGGACGGAGCTCGCACACAGGACG
AGGATCCAGTTGCTCACCGGCCAGTTCACCAAGTCGCCATCCCAGTGCCG
TCAGTCCGGTGAGCTCCCTCAACCACTCCATGATGCAGCAGATGCAGCAA
CAGCAGCAACAACAGCAGCAGCAACAGCAGCAGCAGCAACACCATCAGCT
CAGCCCCCCGCCACATGGAATGCCATCGGGCAACGGACTGCCGACGGGCC
TACCGCCCAGAATGCCCCATGGACTGCCGCCCCATTCGCTGGGGCTCCTC
AACTCCCTGCAGATGATGCACCATGCCTCCCCCTTGGAACTGATGGCCGC
CGCCCATCACCATGTGCCTCCAAGGTCGTACAACTCACCGCCGCCGATCT
CCACCTCGGATCCCAGTGCCAATGAGTGCAAGCTGGTGGAGTACCGGGGT
CAGAAGGTCGCCGCATTCATAATTAGCAACGAAACGATGCTCTGCCTGCC
GCAGGCCTTCGAGCTCTTCCTGAAGCACTTGGTCGGCGGTCTGCATACGG
TTTATACCAAACTAAAGCGCCTTGACATCGTACCGCTCGTCTGCAATGTG
GAACAGGTGCGCATATTACGCGGCTTGGGCGCCATCCAGCCGGGCGTCAA
TCGCTGCAAGTTGCTCTGCTGCAAGGACTTCGACATCCTCTACAGGGACT
GCACCACGGCCAGATGCCTATCGATCAAGCCACCAGAAAGGTAAACACAC
AAGTATAATAAAAAAACTATGGCAATAACTTTTCTCCTCCTACTTTTTGG
TTTTTTTTTTTTTTGGTTATTATTTATTTAACGAAAAAAAAAAAAAA

RE64054.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
dac-RE 5386 dac-RE 102..1991 1..1890 9405 99.8 Plus
dac-RF 4995 dac-RF 599..1627 862..1890 5130 99.9 Plus
dac-RB 5037 dac-RB 614..1642 862..1890 5130 99.9 Plus
dac-RF 4995 dac-RF 367..600 1..234 1155 99.5 Plus
dac-RB 5037 dac-RB 382..615 1..234 1155 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16482626..16484488 1863..1 9225 99.7 Minus
chr2L 23010047 chr2L 16480250..16480372 1983..1861 615 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
dac-RF 3219 CG4952-PF 1..962 929..1890 4795 99.9 Plus
dac-RB 3246 CG4952-PB 1..962 929..1890 4795 99.9 Plus
dac-RD 3225 CG4952-PD 1..962 929..1890 4795 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:09:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
dac-RF 4955 CG4952-RF 561..1589 862..1890 5130 99.9 Plus
dac-RB 4982 CG4952-RB 561..1589 862..1890 5130 99.9 Plus
dac-RD 4961 CG4952-RD 561..1589 862..1890 5130 99.9 Plus
dac-RF 4955 CG4952-RF 329..562 1..234 1155 99.6 Plus
dac-RB 4982 CG4952-RB 329..562 1..234 1155 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
dac-PF 1072 CG4952-PF 1..321 929..1891 1100 100 Plus
dac-PD 1074 CG4952-PD 1..320 929..1888 1095 100 Plus
dac-PB 1081 CG4952-PB 1..320 929..1888 1095 100 Plus
dac-PC 1065 CG4952-PC 1..321 929..1891 1058 97.8 Plus
dac-PG 1063 CG4952-PG 1..319 929..1891 1054 98.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16483808..16485670 1863..1 9270 99.8 Minus
2L 23513712 2L 16481421..16481554 1994..1861 640 98.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16483808..16485670 1863..1 9270 99.8 Minus
2L 23513712 2L 16481421..16481554 1994..1861 640 98.5 Minus
Blast to na_te.dros performed 2014-11-27 09:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
BS 5142 BS BS 5142bp 5093..5142 1980..1931 151 78 Minus
Doc 4725 Doc DMW1DOC 4725bp Derived from X17551 (g8821) (Rel. 29, Last updated, Version 2). 4684..4721 1981..1944 127 81.6 Minus
accord2 7650 accord2 QBERT 7650bp 7001..7039 1942..1980 123 79.5 Plus
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 150..203 1978..1925 117 68.5 Minus

RE64054.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:53:59 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16483432..16484488 1..1057 99   Minus
chr2L 16483205..16483366 1123..1284 100 == Minus
chr2L 16482626..16483139 1350..1863 99 == Minus
chr2L 16480250..16480369 1864..1983 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:30:20 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RB 1..965 929..1894 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:37:03 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RB 1..965 929..1894 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:52:35 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RD 1..970 929..1898 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:08:05 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RB 1..965 929..1894 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:53:59 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RD 1..970 929..1898 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:02:24 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RE 1..1893 1..1894 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:37:03 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RE 1..1893 1..1894 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:52:35 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RD 561..1597 862..1898 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:08:05 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RE 1..1893 1..1894 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:53:59 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RD 561..1597 862..1898 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:53:59 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16483808..16485670 1..1863 99   Minus
2L 16481432..16481551 1864..1983 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:52:35 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16483808..16485670 1..1863 99   Minus
arm_2L 16481432..16481551 1864..1983 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:42:07 Download gff for RE64054.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16483808..16485670 1..1863 99   Minus
2L 16481432..16481551 1864..1983 100 <- Minus

RE64054.hyp Sequence

Translation from 928 to 1893

> RE64054.hyp
MDSVTSEQSENNNNKAGAINNNINSGIERAAGNMNTTAMLMHHQQQQQAA
AAAAAAAAQQQQQQHNGRDGSNSSRGANEDRPNGRSSHTGRGSSCSPASS
PSRHPSAVSPVSSLNHSMMQQMQQQQQQQQQQQQQQQHHQLSPPPHGMPS
GNGLPTGLPPRMPHGLPPHSLGLLNSLQMMHHASPLELMAAAHHHVPPRS
YNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKH
LVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKD
FDILYRDCTTARCLSIKPPER*

RE64054.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
dac-PF 1072 CG4952-PF 1..321 1..321 1700 100 Plus
dac-PD 1074 CG4952-PD 1..320 1..320 1695 100 Plus
dac-PB 1081 CG4952-PB 1..320 1..320 1695 100 Plus
dac-PC 1065 CG4952-PC 1..321 1..321 1658 97.8 Plus
dac-PG 1063 CG4952-PG 1..319 1..321 1654 98.1 Plus

RE64054.pep Sequence

Translation from 928 to 1893

> RE64054.pep
MDSVTSEQSENNNNKAGAINNNINSGIERAAGNMNTTAMLMHHQQQQQAA
AAAAAAAAQQQQQQHNGRDGSNSSRGANEDRPNGRSSHTGRGSSCSPASS
PSRHPSAVSPVSSLNHSMMQQMQQQQQQQQQQQQQQQHHQLSPPPHGMPS
GNGLPTGLPPRMPHGLPPHSLGLLNSLQMMHHASPLELMAAAHHHVPPRS
YNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKH
LVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKD
FDILYRDCTTARCLSIKPPER*

RE64054.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 17:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15881-PA 1051 GF15881-PA 1..281 34..320 1127 91.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 17:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20126-PA 1054 GG20126-PA 1..295 34..320 1240 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 17:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25029-PA 1163 GH25029-PA 64..391 30..320 1143 81 Plus
Dgri\GH17983-PA 392 GH17983-PA 64..392 30..321 1134 81 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 17:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
dac-PF 1072 CG4952-PF 1..321 1..321 1700 100 Plus
dac-PD 1074 CG4952-PD 1..320 1..320 1695 100 Plus
dac-PB 1081 CG4952-PB 1..320 1..320 1695 100 Plus
dac-PC 1065 CG4952-PC 1..321 1..321 1658 97.8 Plus
dac-PG 1063 CG4952-PG 1..319 1..321 1654 98.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 17:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13824-PA 1109 GI13824-PA 131..381 68..320 1125 91.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 17:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18480-PA 1033 GL18480-PA 1..305 34..320 1203 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 17:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18550-PA 1141 GA18550-PA 89..413 13..320 1210 87.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 17:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17175-PA 838 GM17175-PA 62..118 264..320 333 100 Plus
Dsec\GM17175-PA 838 GM17175-PA 1..61 34..97 192 87.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 17:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21910-PA 850 GD21910-PA 1..317 1..320 1394 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 17:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17453-PA 1064 GJ17453-PA 48..349 20..320 1191 89.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 17:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24323-PA 1094 GK24323-PA 58..313 66..320 1099 92.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 17:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12814-PA 1074 GE12814-PA 1..318 1..320 1377 96.6 Plus