Clone RE64859 Report

Search the DGRC for RE64859

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:648
Well:59
Vector:pFlc-1
Associated Gene/Transcriptl(3)neo38-RB
Protein status:RE64859.pep: gold
Sequenced Size:2260

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6930-RA 2010-03-18 Manual selection by Sue Celniker

Clone Sequence Records

RE64859.complete Sequence

2260 bp assembled on 2010-09-29

GenBank Submission: BT125681.1

> RE64859.complete
AGTTTGATGTCGGAGCCTCGACGAGCCGGTCGTAAGCGAAATCGTAAGCG
AGACTTTAGTGCGATTCCGCTCCGTTCCGCCGGTTGTGTGTGCGTGCTTA
GTTCGAGCTGAGGCGAAGCAGAAGCAGAATCGGAATCAGAATCCAGCGGA
ATCGAGAATCAAAATCGAAACCGAAAGTGGTTCTCCGCGTGTGCGAGCTA
GTGTGTGTGTGTGTGTACGTGTTGTGTTTGGGCCCGCTTTTCTGCTTTTC
TACCCCCGAAAAAGCAAAGCACAGCATAAAACTGTGCGCTCGTAAGCGCG
TACGTGTGTCTATGTGCCTCTGTGTGAGTGCTAGTGTATGAGTGCGACCA
GGGGAAAGGAGGCAAAGAAAAGAAAACCAACCCCCACCAGCGACGGCGGA
GAACAGGAAAACAACAACAGAAGGCACACAACCAGCGCACCACCACCATC
ATTACCATTACCGCCACCACCCACTACAACACTTCGTCATCGTTTCGCGT
TGTGCAGAAAATAATTACAAAAAAGAAAAGAAATAGAATTGCAAGTAATA
TTAGCGACCGATCGAGTTTTAGTGCTAAAGCGATTCGAAAGATTGTCTTG
CTTAAACCAAAAGGGCCCCTCGAGGCCCTAGAACTACTATCCATTACCCC
GCCGATCATCCCGATCCTGACATGATGAACTTCTCCGCGTTCGGCGGCCC
CTTCTCCGGCATCCACCAATTTGCCGCTAAATTCGACGCCCAGACGCCGG
GCGCCTTCGGCACGCCCCCCGCGGCTGCCGCGAATGCAGCAGCCGCAGCG
GCAGCGGCCGGCACCGATAACCATGTGCAGCGATATCAGACCAATGGCAA
TCACTTTAATCAGAATGTGCCCAACGTTTCGGCTGCCAACAACATGCAAT
ATGGCCAGAATATCTCCATACCGTACTCACAGCCGCAGGGTGATCTAAAC
TTTCTCAATGCAGCCGCTGCGGCCGATCATAAGGGTAAAATCCATCCAAA
AATCGAACGTGACCGGGAAGAAGTCCTCAACCAGCAGATCCTGCAGAATG
TCAACCAATCCTGGCAGACGTTGGCAAATACGGCCAACACGGTGGACTAC
TCGTCACACCTGCTCTCCGCCACACTGCCCATCTCCATACAGCACTTCCT
CAAGTACTCGGAGACGATCAAGAAGGAGTCCACCGGCGATGTCCTGAAGA
ACGGCACCAATTTGGCCAGCCTGGCGCTGGGGGGCGTGGCCCTAACGCCC
AGCAACAACGGTGCGAATGGCGGCCACCACAACGGACTGGTGGGCATGGA
CCATGGCGGTCACATGACCAACATGACGGACGCCAACGGAGCGGCGCTGA
CGAACGGAGCTAGCAACGGAGTGAATGGCAATGCTAACGGCACTGTGACC
AATGGTGGCGCCGGCGCCGTCTCGAGCTCCGGATCTGTGGGCACAACAAA
CGCCAGCGGCGGCACAGGCACGGCCAGCGGCAAGAAGACCAAAAAGAAGA
AACCACCAAAGGAGAAGAAGCCGCGCCCCAAACCGGGAGAAATCCGCGAG
ACAAAGGCGCTGGATGGCTCGACGCTCTACTGCTGCCCGGAGTGCCAAAT
GGCCTACCCGGATCGCAGCCTCATCGAGCAGCACGTCATCTCGCACGCCG
TTGAGCGGCGCTTCGTCTGCGACATCTGCAATGCGGCGCTGAAGCGCAAG
GACCACCTGACCAGGCACAAGCTCTCCCACATACCGGACAGGCCGCATGT
GTGCAATATCTGCATGAAGTCCTTCAAGCGCAAGGAGCAGCTCACTCTGC
ACATTGTCATCCATTCCGGCGAGAAGAAGCATGTTTGCATTGAGTGTGGA
AAAGGTTTCTATCGCAAGGATCACTTGCGCAAGCACACACGATCGCACAT
CGCCCGGCGTGTCAAGTCGGAGGTGTCGGCGCAGAACGTTAACGGATCCG
CCGGAGGCGGTGGCGGCGGTGGAGGCGGCAACAGTGCGCAGAGCAACGCG
CTGCACGGCTCCTGAGGATCGTACAAGGACTTCTGGTAAACTCCCAGCCG
AATTTCAAGCCATAAGGGGCGGCCAGCCTGCTGGCGGCGGTGGACAGGTG
GTGTTCGTATACGGATACGACTGACTGCCGCCGGGAGCAGGCGAGCTGCC
TTTGAAATTCGCTGGGGGCTTACCGGGGGTCCTGCTGAGCGTCACCCAAC
TCCAATTACAATAACCCTCAATAAACACGAGTTATACTTACTGTAAAAAA
AAAAAAAAAA

RE64859.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7602980..7603855 876..1 4335 99.7 Minus
chr3R 27901430 chr3R 7594887..7595622 1757..1022 3680 100 Minus
chr3R 27901430 chr3R 7594128..7594519 2244..1853 1960 100 Minus
chr3R 27901430 chr3R 7596676..7596823 1023..876 740 100 Minus
chr3R 27901430 chr3R 7594573..7594671 1856..1758 495 100 Minus
chr3L 24539361 chr3L 11594853..11595111 1658..1916 470 78.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RL 1368 CG6930-PL 1..1368 672..2039 6840 100 Plus
l(3)neo38-RK 1344 CG6930-PK 1..1344 672..2015 6720 100 Plus
l(3)neo38-RC 1344 CG6930-PC 1..1344 672..2015 6720 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RL 2247 CG6930-RL 4..2247 1..2244 11220 100 Plus
l(3)neo38-RC 2247 CG6930-RC 4..2247 1..2244 11220 100 Plus
l(3)neo38-RB 6236 CG6930-RB 420..2663 1..2244 11220 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PL 455 CG6930-PL 1..455 672..2036 1543 99.8 Plus
l(3)neo38-PK 447 CG6930-PK 1..418 672..1925 1505 100 Plus
l(3)neo38-PC 447 CG6930-PC 1..418 672..1925 1505 100 Plus
l(3)neo38-PB 447 CG6930-PB 1..418 672..1925 1505 100 Plus
l(3)neo38-PD 434 CG6930-PD 1..405 672..1925 1415 94.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11777474..11778349 876..1 4380 100 Minus
3R 32079331 3R 11769370..11770105 1757..1022 3680 100 Minus
3R 32079331 3R 11768610..11769002 2245..1853 1965 100 Minus
3R 32079331 3R 11771154..11771301 1023..876 740 100 Minus
3R 32079331 3R 11769056..11769154 1856..1758 495 100 Minus
3L 28110227 3L 11603938..11604196 1658..1916 470 78.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11518305..11519180 876..1 4380 100 Minus
3R 31820162 3R 11510201..11510936 1757..1022 3680 100 Minus
3R 31820162 3R 11509441..11509833 2245..1853 1965 100 Minus
3R 31820162 3R 11511985..11512132 1023..876 740 100 Minus
3R 31820162 3R 11509887..11509985 1856..1758 495 100 Minus
3L 28103327 3L 11597141..11597206 1761..1826 225 89.3 Plus
3L 28103327 3L 11597222..11597296 1842..1916 195 84 Plus
3L 28103327 3L 11597038..11597100 1658..1720 180 85.7 Plus
Blast to na_te.dros performed on 2014-11-27 15:53:10 has no hits.

RE64859.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:39:25 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7602980..7603855 1..876 95   Minus
chr3R 7596676..7596822 877..1023 100 <- Minus
chr3R 7594887..7595620 1024..1757 100 <- Minus
chr3R 7594575..7594671 1758..1854 100 <- Minus
chr3R 7594128..7594517 1855..2244 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-09-29 16:49:29 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RC 1..1344 672..2015 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:41:54 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RC 1..1344 672..2015 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:17:42 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RL 1..1368 672..2039 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:39:25 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RL 1..1368 672..2039 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-29 16:49:28 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RC 1..2242 1..2242 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:41:54 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RC 1..2242 1..2242 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:17:42 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RB 420..2663 1..2244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:39:25 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RB 420..2663 1..2244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:39:25 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11777474..11778349 1..876 100   Minus
3R 11771154..11771300 877..1023 100 <- Minus
3R 11769370..11770103 1024..1757 100 <- Minus
3R 11769058..11769154 1758..1854 100 <- Minus
3R 11768611..11769000 1855..2244 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:17:42 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7603196..7604071 1..876 100   Minus
arm_3R 7596876..7597022 877..1023 100 <- Minus
arm_3R 7595092..7595825 1024..1757 100 <- Minus
arm_3R 7594780..7594876 1758..1854 100 <- Minus
arm_3R 7594333..7594722 1855..2244 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:45:23 Download gff for RE64859.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11518305..11519180 1..876 100   Minus
3R 11511985..11512131 877..1023 100 <- Minus
3R 11510201..11510934 1024..1757 100 <- Minus
3R 11509889..11509985 1758..1854 100 <- Minus
3R 11509442..11509831 1855..2244 100 <- Minus

RE64859.pep Sequence

Translation from 671 to 2014

> RE64859.pep
MMNFSAFGGPFSGIHQFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDN
HVQRYQTNGNHFNQNVPNVSAANNMQYGQNISIPYSQPQGDLNFLNAAAA
ADHKGKIHPKIERDREEVLNQQILQNVNQSWQTLANTANTVDYSSHLLSA
TLPISIQHFLKYSETIKKESTGDVLKNGTNLASLALGGVALTPSNNGANG
GHHNGLVGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAV
SSSGSVGTTNASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGS
TLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKRKDHLTRHK
LSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKD
HLRKHTRSHIARRVKSEVSAQNVNGSAGGGGGGGGGNSAQSNALHGS*

RE64859.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 14:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16617-PA 451 GF16617-PA 1..451 1..447 1996 93.8 Plus
Dana\GF16931-PA 1364 GF16931-PA 1182..1312 278..413 228 36.5 Plus
Dana\GF23400-PA 940 GF23400-PA 388..498 299..409 224 41.4 Plus
Dana\GF23400-PA 940 GF23400-PA 297..414 292..409 217 37.3 Plus
Dana\GF23400-PA 940 GF23400-PA 417..526 300..409 216 39.1 Plus
Dana\GF18492-PA 929 GF18492-PA 676..835 280..429 211 36 Plus
Dana\GF23400-PA 940 GF23400-PA 478..582 305..409 209 39 Plus
Dana\GF23400-PA 940 GF23400-PA 360..470 299..409 209 39.6 Plus
Dana\GF19706-PA 454 GF19706-PA 148..254 303..409 209 35.5 Plus
Dana\GF16931-PA 1364 GF16931-PA 1226..1336 299..409 200 36 Plus
Dana\GF23400-PA 940 GF23400-PA 269..386 292..409 200 34.7 Plus
Dana\GF23400-PA 940 GF23400-PA 444..554 299..409 196 37.8 Plus
Dana\GF23400-PA 940 GF23400-PA 332..442 299..409 184 35.1 Plus
Dana\GF23400-PA 940 GF23400-PA 506..615 305..413 182 37.3 Plus
Dana\GF19706-PA 454 GF19706-PA 206..308 305..407 181 35 Plus
Dana\GF23400-PA 940 GF23400-PA 534..639 305..409 178 36.8 Plus
Dana\GF23400-PA 940 GF23400-PA 562..671 305..409 156 34.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 14:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17195-PA 446 GG17195-PA 1..446 2..447 2377 100 Plus
Dere\GG15515-PA 529 GG15515-PA 309..442 287..420 577 70.1 Plus
Dere\GG22637-PA 1243 GG22637-PA 1034..1125 328..417 225 41.3 Plus
Dere\GG13168-PA 926 GG13168-PA 291..432 248..409 223 34.6 Plus
Dere\GG10297-PA 612 GG10297-PA 36..146 299..409 218 41.4 Plus
Dere\GG13168-PA 926 GG13168-PA 458..632 229..413 207 29.2 Plus
Dere\GG13168-PA 926 GG13168-PA 547..659 300..410 159 29.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 14:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23160-PA 370 GH23160-PA 3..370 70..447 1631 92.1 Plus
Dgri\GH14859-PA 551 GH14859-PA 339..470 287..418 588 72 Plus
Dgri\GH15079-PA 1205 GH15079-PA 1040..1131 328..417 224 41.3 Plus
Dgri\GH13073-PA 979 GH13073-PA 417..527 299..409 223 41.4 Plus
Dgri\GH13073-PA 979 GH13073-PA 326..443 292..409 216 37.3 Plus
Dgri\GH13073-PA 979 GH13073-PA 447..555 301..409 215 39.4 Plus
Dgri\GH14766-PA 967 GH14766-PA 336..443 302..409 214 38 Plus
Dgri\GH13073-PA 979 GH13073-PA 507..611 305..409 208 39 Plus
Dgri\GH13073-PA 979 GH13073-PA 389..499 299..409 208 39.6 Plus
Dgri\GH13073-PA 979 GH13073-PA 298..415 292..409 198 34.7 Plus
Dgri\GH13073-PA 979 GH13073-PA 473..583 299..409 195 37.8 Plus
Dgri\GH13073-PA 979 GH13073-PA 361..471 299..409 182 35.1 Plus
Dgri\GH13073-PA 979 GH13073-PA 535..644 305..413 181 37.3 Plus
Dgri\GH13073-PA 979 GH13073-PA 563..668 305..409 177 36.8 Plus
Dgri\GH13073-PA 979 GH13073-PA 591..700 305..409 153 34.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PL 455 CG6930-PL 1..447 1..447 2369 100 Plus
l(3)neo38-PK 447 CG6930-PK 1..447 1..447 2369 100 Plus
l(3)neo38-PC 447 CG6930-PC 1..447 1..447 2369 100 Plus
l(3)neo38-PB 447 CG6930-PB 1..447 1..447 2369 100 Plus
l(3)neo38-PD 434 CG6930-PD 1..434 1..447 2275 97.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 14:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10303-PA 438 GI10303-PA 1..413 2..420 1877 92.9 Plus
Dmoj\GI13709-PA 559 GI13709-PA 332..465 287..420 578 70.9 Plus
Dmoj\GI23713-PA 1171 GI23713-PA 1011..1102 328..417 225 41.3 Plus
Dmoj\GI11869-PA 996 GI11869-PA 330..455 288..413 222 35.7 Plus
Dmoj\GI17692-PA 965 GI17692-PA 401..511 299..409 221 41.4 Plus
Dmoj\GI11869-PA 996 GI11869-PA 494..668 233..413 205 28.7 Plus
Dmoj\GI11869-PA 996 GI11869-PA 583..695 300..410 157 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 14:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12249-PA 438 GL12249-PA 1..438 1..447 1893 93.5 Plus
Dper\GL22806-PA 457 GL22806-PA 242..375 287..420 567 69.4 Plus
Dper\GL18890-PA 932 GL18890-PA 379..489 299..409 221 41.4 Plus
Dper\GL18890-PA 932 GL18890-PA 288..405 292..409 215 37.3 Plus
Dper\GL18890-PA 932 GL18890-PA 408..517 300..409 214 39.1 Plus
Dper\GL20485-PA 318 GL20485-PA 123..233 303..413 213 36.9 Plus
Dper\GL18890-PA 932 GL18890-PA 469..573 305..409 207 39 Plus
Dper\GL18890-PA 932 GL18890-PA 351..461 299..409 207 39.6 Plus
Dper\GL20484-PA 235 GL20484-PA 62..176 299..413 205 35.7 Plus
Dper\GL20485-PA 318 GL20485-PA 175..288 299..412 199 36.8 Plus
Dper\GL18890-PA 932 GL18890-PA 260..377 292..409 197 34.7 Plus
Dper\GL18890-PA 932 GL18890-PA 435..545 299..409 193 37.8 Plus
Dper\GL20485-PA 318 GL20485-PA 119..201 327..409 183 41 Plus
Dper\GL18890-PA 932 GL18890-PA 323..433 299..409 181 35.1 Plus
Dper\GL18890-PA 932 GL18890-PA 497..606 305..413 179 37.3 Plus
Dper\GL18890-PA 932 GL18890-PA 525..630 305..409 175 36.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 14:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19962-PA 438 GA19962-PA 1..438 1..447 1946 95.3 Plus
Dpse\GA20302-PA 529 GA20302-PA 314..447 287..420 577 69.4 Plus
Dpse\GA27565-PA 1219 GA27565-PA 1063..1154 328..417 229 41.3 Plus
Dpse\GA25849-PB 870 GA25849-PB 297..407 299..409 222 41.4 Plus
Dpse\GA25849-PB 870 GA25849-PB 409..519 299..409 217 40.5 Plus
Dpse\GA25849-PB 870 GA25849-PB 206..323 292..409 215 37.3 Plus
Dpse\GA15299-PA 916 GA15299-PA 588..710 291..413 212 34.1 Plus
Dpse\GA25849-PB 870 GA25849-PB 326..435 300..409 208 38.2 Plus
Dpse\GA25849-PB 870 GA25849-PB 387..491 305..409 208 39 Plus
Dpse\GA25849-PB 870 GA25849-PB 269..379 299..409 207 39.6 Plus
Dpse\GA25849-PB 870 GA25849-PB 353..463 299..409 181 35.1 Plus
Dpse\GA25849-PB 870 GA25849-PB 241..351 299..409 181 35.1 Plus
Dpse\GA25849-PB 870 GA25849-PB 443..552 305..413 180 37.3 Plus
Dpse\GA25849-PB 870 GA25849-PB 471..576 305..409 175 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 14:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26073-PA 380 GM26073-PA 3..380 70..447 2014 100 Plus
Dsec\GM10968-PA 929 GM10968-PA 385..495 299..409 222 41.4 Plus
Dsec\GM22079-PA 964 GM22079-PA 313..438 288..413 222 35.7 Plus
Dsec\GM15276-PA 1236 GM15276-PA 1014..1103 328..415 218 40 Plus
Dsec\GM10968-PA 929 GM10968-PA 294..411 292..409 216 37.3 Plus
Dsec\GM10968-PA 929 GM10968-PA 414..523 300..409 215 39.1 Plus
Dsec\GM22706-PA 1560 GM22706-PA 1297..1409 305..414 215 40.5 Plus
Dsec\GM10968-PA 929 GM10968-PA 475..579 305..409 208 39 Plus
Dsec\GM10968-PA 929 GM10968-PA 357..467 299..409 208 39.6 Plus
Dsec\GM22079-PA 964 GM22079-PA 495..669 229..413 206 29.2 Plus
Dsec\GM10968-PA 929 GM10968-PA 266..383 292..409 198 34.7 Plus
Dsec\GM10968-PA 929 GM10968-PA 441..551 299..409 194 37.8 Plus
Dsec\GM10968-PA 929 GM10968-PA 329..439 299..409 182 35.1 Plus
Dsec\GM10968-PA 929 GM10968-PA 503..612 305..413 180 37.3 Plus
Dsec\GM10968-PA 929 GM10968-PA 531..636 305..409 176 36.8 Plus
Dsec\GM22079-PA 964 GM22079-PA 584..696 300..410 157 29.2 Plus
Dsec\GM10968-PA 929 GM10968-PA 559..668 305..409 153 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 14:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20637-PA 447 GD20637-PA 1..447 1..447 2360 99.1 Plus
Dsim\GD19200-PA 1019 GD19200-PA 865..956 328..417 226 41.3 Plus
Dsim\GD22157-PA 782 GD22157-PA 233..343 299..409 223 41.4 Plus
Dsim\GD22157-PA 782 GD22157-PA 262..371 300..409 215 39.1 Plus
Dsim\GD19092-PA 910 GD19092-PA 654..808 269..417 212 33.8 Plus
Dsim\GD23545-PA 558 GD23545-PA 220..344 288..409 209 37.6 Plus
Dsim\GD22157-PA 782 GD22157-PA 323..427 305..409 208 39 Plus
Dsim\GD22157-PA 782 GD22157-PA 289..399 299..409 195 37.8 Plus
Dsim\GD22157-PA 782 GD22157-PA 351..460 305..413 180 37.3 Plus
Dsim\GD22157-PA 782 GD22157-PA 379..484 305..409 176 36.8 Plus
Dsim\GD22157-PA 782 GD22157-PA 407..516 305..409 153 34.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 14:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10157-PA 434 GJ10157-PA 1..434 1..447 1876 88 Plus
Dvir\GJ14051-PA 545 GJ14051-PA 328..461 287..420 580 70.9 Plus
Dvir\GJ23272-PA 1185 GJ23272-PA 1017..1108 328..417 227 41.3 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 406..516 299..409 222 41.4 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 326..432 303..409 216 39.3 Plus
Dvir\GJ18900-PA 571 GJ18900-PA 403..513 299..409 216 40.5 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 436..544 301..409 215 39.4 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 496..600 305..409 208 39 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 378..488 299..409 208 39.6 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 287..404 292..409 198 34.7 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 462..572 299..409 194 37.8 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 350..460 299..409 182 35.1 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 524..633 305..413 180 37.3 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 552..657 305..409 176 36.8 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 580..689 305..409 153 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 14:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11983-PA 447 GK11983-PA 1..447 2..447 1821 87.7 Plus
Dwil\GK17174-PA 563 GK17174-PA 341..474 287..420 584 70.1 Plus
Dwil\GK20499-PA 919 GK20499-PA 223..422 187..409 233 29.6 Plus
Dwil\GK11242-PA 923 GK11242-PA 765..859 328..420 222 41.1 Plus
Dwil\GK14973-PA 1011 GK14973-PA 394..504 299..409 219 40.5 Plus
Dwil\GK20499-PA 919 GK20499-PA 514..622 305..413 203 33.9 Plus
Dwil\GK20499-PA 919 GK20499-PA 537..649 300..410 156 29.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 14:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10087-PA 446 GE10087-PA 1..446 2..447 2369 99.6 Plus
Dyak\GE12687-PA 782 GE12687-PA 233..343 299..409 223 41.4 Plus
Dyak\GE19490-PA 815 GE19490-PA 307..428 288..409 220 36.1 Plus
Dyak\GE13170-PA 481 GE13170-PA 345..451 303..409 219 42.1 Plus
Dyak\GE17353-PA 1584 GE17353-PA 1328..1440 305..414 216 40.5 Plus
Dyak\GE12687-PA 782 GE12687-PA 262..371 300..409 215 39.1 Plus
Dyak\GE12687-PA 782 GE12687-PA 323..427 305..409 208 39 Plus
Dyak\GE19490-PA 815 GE19490-PA 454..628 229..413 206 29.2 Plus
Dyak\GE12687-PA 782 GE12687-PA 289..399 299..409 195 37.8 Plus
Dyak\GE12687-PA 782 GE12687-PA 351..460 305..413 180 37.3 Plus
Dyak\GE12687-PA 782 GE12687-PA 379..484 305..409 176 36.8 Plus
Dyak\GE13170-PA 481 GE13170-PA 319..423 305..409 172 37.1 Plus
Dyak\GE19490-PA 815 GE19490-PA 543..655 300..410 158 29.2 Plus
Dyak\GE12687-PA 782 GE12687-PA 407..516 305..409 153 34.5 Plus

RE64859.hyp Sequence

Translation from 671 to 2014

> RE64859.hyp
MMNFSAFGGPFSGIHQFAAKFDAQTPGAFGTPPAAAANAAAAAAAAGTDN
HVQRYQTNGNHFNQNVPNVSAANNMQYGQNISIPYSQPQGDLNFLNAAAA
ADHKGKIHPKIERDREEVLNQQILQNVNQSWQTLANTANTVDYSSHLLSA
TLPISIQHFLKYSETIKKESTGDVLKNGTNLASLALGGVALTPSNNGANG
GHHNGLVGMDHGGHMTNMTDANGAALTNGASNGVNGNANGTVTNGGAGAV
SSSGSVGTTNASGGTGTASGKKTKKKKPPKEKKPRPKPGEIRETKALDGS
TLYCCPECQMAYPDRSLIEQHVISHAVERRFVCDICNAALKRKDHLTRHK
LSHIPDRPHVCNICMKSFKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKD
HLRKHTRSHIARRVKSEVSAQNVNGSAGGGGGGGGGNSAQSNALHGS*

RE64859.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PL 455 CG6930-PL 1..447 1..447 2369 100 Plus
l(3)neo38-PK 447 CG6930-PK 1..447 1..447 2369 100 Plus
l(3)neo38-PC 447 CG6930-PC 1..447 1..447 2369 100 Plus
l(3)neo38-PB 447 CG6930-PB 1..447 1..447 2369 100 Plus
l(3)neo38-PD 434 CG6930-PD 1..434 1..447 2275 97.1 Plus