Clone RE66324 Report

Search the DGRC for RE66324

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:663
Well:24
Vector:pFlc-1
Associated Gene/TranscriptTraf-like-RA
Protein status:RE66324.pep: gold
Sequenced Size:2261

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Traf-like-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE66324.complete Sequence

2261 bp assembled on 2011-01-07

GenBank Submission: BT125880.1

> RE66324.complete
AGTGGATTCTCGGTGGCTGTGTTTTCCTGGTCGTAGTTCGCCAAGTTAGT
GGTCAATACGATTCGTTGGTTGCTCTCGCATTTCGAAATAGTGGTAATCG
CACCAAATGGCAGTGCTATCAGTTCGAGGTTGTCGTATAGATTCCCATGG
ACGCCCTAATGCTAACACATGTGCAAAGCTATATCTAAACCATGTCTGTG
TGCGCCGCGTATGACTATGCCCAAGGAAATTCTTAATCATTTTTGGCTGA
GTTTAGTGTGCATAGGGCGGTGCTCGCAGCGCCAGAGAATTTGCTGATCC
AAAGTTTCAATCGAATTTGCTTTCCTTTAATCAATATAATGTCACTGACC
AAGTCGTCGTCGAGAAAGGATCTAACCGAGCAGAATCAGTATCAGAATCA
GAATGAGAATCAGAATCAGCCCAAATCGACGACCATAGTCAAGTATGAGA
AGTCGTCGTGCCTCTTCTGCAACGAATGGTTCGATGCCCAGACATTCACG
GAACACCTGATCCACTGCGGCCAGGTGCTGGAGGAGTGTCCCAACGGCTG
TCAGGCCTTCATTCCACGCATCCGTATGCGATCCCATCTGAAGGAGTGTC
CACGCAACCAGCACAATCTGAGCAATCAGCAACGCATGAGTGTCAGCATG
GATCGCCTGGATAGGCAGTCGGATCAGCGTCTCCTGGTCATTGAACAGGA
CGTGGGCACCATTCGGTCCGTTCTCAACGAGGAGATACGACAGCGTTTGC
ATCTCATTACCGATGTGGGCAACATACGGAAGCAGAACCAGGTCGTCGAG
GACTGGACCCGCGAAACCGAGAAGGCAATGGACGATCTGCGTCGCCAGAT
GGAGGAGGAAACCAATCGGAAGGCATTCGCCATCGAACAGAACCAGCTGG
ATGTCCAGTACTGCTGTGATATCACACAGTCCTTGAAAGAGCAAGTGGAG
TCCAGGCTGGATGAGGCCCAAAAGCTGGTCAATCAGCTCTCGGCGGACGT
GACCTATCACCAGAATCAGCTAAACGACAATATCCTAAAGCTGGAGGAGC
TGATCTTTGAGAACGAGCGGCTCAACAGGGAGAAGTTCTTTCAGATCGAG
GAGTTTCTGCAGCAGATCAATGAGGACATCAAAACAAAGCTGGGCAACAG
TGACTATGTGACGTCAAAGCAGGCCACATTGGACTATGAGGTGAAGAATG
TGAAGAACATTGTGTGCGAAACGGAGGAACGTTGCGATAAATTGGATCGA
GCACTTCACCAGACCATGCAGAATATATCGGATTTGGAGACCCAAATGGC
CATGCAGCAGCGGATTGCCAGTGTCCAGAATATAAGGGGACACTTGATTT
GGCGCATCAAGGATTACTCGAAAAAACTGGAAGAGTCCAAGCAGTACGAC
ACCATCCTCCATAGCGCCATGTTCTCCAATAAAGCCTTTGGCTATGCTCT
ACGGCTGGATATATACTTGAATGGCAAGGGCACCTGGAAGGGCAGGAACA
TGATCGCCTGCTTGAACGTTCTATCCGGAGAGTACGATCCCCTTCTGGCC
TGGCCATGCCGCCTTCAGGCCGAGATCATCATCCGGGATCAGTGCACGAA
TGTGGCAGATGCCGAGGATTATGTGAAGACCATCTTTGTGCGCAAGAAGA
GCGATGATTTTATCCAAAGCAACCAGTACTTCCATATACCACACAAGGTA
ATCACCAGTCGCAACTATCTTCGCAACGATTCCATGTTCATCGAGGTTCG
AGTTCTAAAATAAAACCCATGCAGCATCGCTATCCCACCCACCAGGAGCG
ATAAGAAAAAAAAAATCCAATTGCGGATTGTCACATACATAAAACATAAT
TTATTCCATTGAGAGCGAACTGGAAGTTAAAAACCCGCTTACAAACACGA
GTATGTGTACATATATAGTGTATAAGTGCATACGAATCGATTCATCGTTT
CAATATGCGTATATTGTAGTTTTAAATGTCATTGCAGTTTTAAATGCTTT
TTTTCAAATTAGGCAATAGTCACATTGAGGCACTGTCGAGACGAAGTCGG
TAGTTAGAAAGCATAGCTTTTATTGCAACATTTCCCTGGTCACTTTGTCA
AGATATAAGCAACTCTTTCATTTTTTGGTTTTTCATTTCGAGCAAATTAA
CAAGCGATTTTTGAGAGGAACTTCCATATTATTTGTCTTTACGAACGCAT
TTAAATACAAAGGTCTTTTAATAAAATACAACTTCAACACTTGCCAAAAA
AAAAAAAAAAA

RE66324.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16306521..16307311 1454..2243 3830 99.2 Plus
chrX 22417052 chrX 16304813..16305313 1..501 2505 100 Plus
chrX 22417052 chrX 16305383..16305812 500..929 2135 99.8 Plus
chrX 22417052 chrX 16305880..16306291 928..1339 1985 98.8 Plus
chrX 22417052 chrX 16306345..16306461 1338..1454 585 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-RA 1425 CG4394-PA 1..1425 339..1763 7125 100 Plus
Traf-like-RC 1359 CG4394-PC 96..1359 500..1763 6320 100 Plus
Traf-like-RE 1188 CG4394-PE 1..1188 576..1763 5940 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:48:01
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-RA 2285 CG4394-RA 41..2283 1..2243 11215 100 Plus
Traf-like-RE 2275 CG4394-RE 530..2273 500..2243 8720 100 Plus
Traf-like-RD 1877 CG4394-RD 132..1875 500..2243 8720 100 Plus
Traf-like-RE 2275 CG4394-RE 41..482 1..442 2210 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-PA 474 CG4394-PA 1..474 339..1760 2379 100 Plus
Traf-like-PC 452 CG4394-PC 33..452 501..1760 2182 100 Plus
Traf-like-PE 395 CG4394-PE 1..395 576..1760 2038 100 Plus
Traf-like-PD 395 CG4394-PD 1..395 576..1760 2038 100 Plus
Traf-like-PG 395 CG4394-PG 1..395 576..1760 2038 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:47:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16416794..16417587 1454..2247 3955 99.9 Plus
X 23542271 X 16415086..16415586 1..501 2505 100 Plus
X 23542271 X 16415656..16416085 500..929 2150 100 Plus
X 23542271 X 16416153..16416564 928..1339 2060 100 Plus
X 23542271 X 16416618..16416734 1338..1454 585 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16424892..16425685 1454..2247 3955 99.8 Plus
X 23527363 X 16423184..16423684 1..501 2505 100 Plus
X 23527363 X 16423754..16424183 500..929 2150 100 Plus
X 23527363 X 16424251..16424662 928..1339 2060 100 Plus
X 23527363 X 16424716..16424832 1338..1454 585 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:48:00 has no hits.

RE66324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:58:24 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16306522..16307313 1455..2245 99   Plus
chrX 16306346..16306461 1339..1454 100 -> Plus
chrX 16305882..16306290 930..1338 98 -> Plus
chrX 16305384..16305812 501..929 99 -> Plus
chrX 16304813..16305312 1..500 92 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-01-07 15:06:00 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 1..1425 339..1763 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:39:14 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 1..1425 339..1763 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:58:24 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 1..1425 339..1763 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-01-07 15:06:00 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 1..2245 1..2245 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:39:14 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 41..2285 1..2245 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:58:24 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
Traf-like-RA 41..2285 1..2245 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:58:24 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
X 16416795..16417585 1455..2245 99   Plus
X 16416619..16416734 1339..1454 100 -> Plus
X 16416155..16416563 930..1338 100 -> Plus
X 16415657..16416085 501..929 100 -> Plus
X 16415086..16415585 1..500 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:39:14 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16310828..16311618 1455..2245 99   Plus
arm_X 16310652..16310767 1339..1454 100 -> Plus
arm_X 16310188..16310596 930..1338 100 -> Plus
arm_X 16309690..16310118 501..929 100 -> Plus
arm_X 16309119..16309618 1..500 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:54:27 Download gff for RE66324.complete
Subject Subject Range Query Range Percent Splice Strand
X 16424893..16425683 1455..2245 99   Plus
X 16424717..16424832 1339..1454 100 -> Plus
X 16424253..16424661 930..1338 100 -> Plus
X 16423755..16424183 501..929 100 -> Plus
X 16423184..16423683 1..500 100 -> Plus

RE66324.pep Sequence

Translation from 338 to 1762

> RE66324.pep
MSLTKSSSRKDLTEQNQYQNQNENQNQPKSTTIVKYEKSSCLFCNEWFDA
QTFTEHLIHCGQVLEECPNGCQAFIPRIRMRSHLKECPRNQHNLSNQQRM
SVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIRKQN
QVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSLK
EQVESRLDEAQKLVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKF
FQIEEFLQQINEDIKTKLGNSDYVTSKQATLDYEVKNVKNIVCETEERCD
KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEES
KQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYD
PLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKSDDFIQSNQYFHI
PHKVITSRNYLRNDSMFIEVRVLK*

RE66324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19567-PA 465 GF19567-PA 1..465 1..474 2020 79.5 Plus
Dana\GF21137-PA 488 GF21137-PA 330..480 331..472 186 30.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17964-PA 474 GG17964-PA 1..474 1..474 2335 93.1 Plus
Dere\GG24997-PA 486 GG24997-PA 328..478 331..472 186 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12698-PA 462 GH12698-PA 10..462 26..474 1955 78.3 Plus
Dgri\GH13208-PA 490 GH13208-PA 332..482 331..472 185 30.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-PA 474 CG4394-PA 1..474 1..474 2470 100 Plus
Traf-like-PC 452 CG4394-PC 33..452 55..474 2182 100 Plus
Traf-like-PE 395 CG4394-PE 1..395 80..474 2038 100 Plus
Traf-like-PD 395 CG4394-PD 1..395 80..474 2038 100 Plus
Traf-like-PG 395 CG4394-PG 1..395 80..474 2038 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14463-PA 467 GI14463-PA 14..467 27..474 1954 78.2 Plus
Dmoj\GI22040-PA 489 GI22040-PA 331..481 331..472 184 30.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15839-PA 345 GL15839-PA 1..342 1..336 1421 81.1 Plus
Dper\GL22390-PA 147 GL22390-PA 2..105 334..437 512 86.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18154-PA 480 GA18154-PA 1..480 1..474 2149 83.6 Plus
Dpse\GA15869-PA 493 GA15869-PA 335..485 331..472 180 29.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13439-PA 460 GM13439-PA 1..460 1..474 2395 95.6 Plus
Dsec\GM18466-PA 520 GM18466-PA 362..512 331..472 187 30.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23279-PA 483 GD23279-PA 325..475 331..472 186 30.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18797-PA 467 GJ18797-PA 1..467 1..474 1965 75.5 Plus
Dvir\GJ16121-PA 493 GJ16121-PA 335..485 331..472 186 30.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25213-PA 476 GK25213-PA 1..476 1..474 2057 80.1 Plus
Dwil\GK24337-PA 489 GK24337-PA 331..481 331..472 184 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Traf3-PA 468 GE17272-PA 1..468 1..474 2448 96.6 Plus
Dyak\Traf1-PA 506 GE18283-PA 348..498 331..472 186 30.1 Plus

RE66324.hyp Sequence

Translation from 338 to 1762

> RE66324.hyp
MSLTKSSSRKDLTEQNQYQNQNENQNQPKSTTIVKYEKSSCLFCNEWFDA
QTFTEHLIHCGQVLEECPNGCQAFIPRIRMRSHLKECPRNQHNLSNQQRM
SVSMDRLDRQSDQRLLVIEQDVGTIRSVLNEEIRQRLHLITDVGNIRKQN
QVVEDWTRETEKAMDDLRRQMEEETNRKAFAIEQNQLDVQYCCDITQSLK
EQVESRLDEAQKLVNQLSADVTYHQNQLNDNILKLEELIFENERLNREKF
FQIEEFLQQINEDIKTKLGNSDYVTSKQATLDYEVKNVKNIVCETEERCD
KLDRALHQTMQNISDLETQMAMQQRIASVQNIRGHLIWRIKDYSKKLEES
KQYDTILHSAMFSNKAFGYALRLDIYLNGKGTWKGRNMIACLNVLSGEYD
PLLAWPCRLQAEIIIRDQCTNVADAEDYVKTIFVRKKSDDFIQSNQYFHI
PHKVITSRNYLRNDSMFIEVRVLK*

RE66324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Traf-like-PA 474 CG4394-PA 1..474 1..474 2470 100 Plus
Traf-like-PC 452 CG4394-PC 33..452 55..474 2182 100 Plus
Traf-like-PE 395 CG4394-PE 1..395 80..474 2038 100 Plus
Traf-like-PD 395 CG4394-PD 1..395 80..474 2038 100 Plus
Traf-like-PG 395 CG4394-PG 1..395 80..474 2038 100 Plus