Clone RE68460 Report

Search the DGRC for RE68460

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:684
Well:60
Vector:pFlc-1
Associated Gene/Transcriptal-RA
Protein status:RE68460.pep: gold
Preliminary Size:1792
Sequenced Size:1823

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3935 2002-01-01 Sim4 clustering to Release 2
CG3935 2002-06-10 Blastp of sequenced clone
CG3935 2003-01-01 Sim4 clustering to Release 3
al 2008-04-29 Release 5.5 accounting
al 2008-08-15 Release 5.9 accounting
al 2008-12-18 5.12 accounting

Clone Sequence Records

RE68460.complete Sequence

1823 bp (1823 high quality bases) assembled on 2002-06-10

GenBank Submission: AY121696

> RE68460.complete
GTAGTTTGCTGCCGGCTCTGGAACAGCCCGGTCATCTCGTCGCGTTCGGT
TCCGATTCCGATTCGAATAGTCGAGCTGGGGATACATTGTTGTTTCCGGG
TTAAAGTGCGTACGATTGCGGAAGTGTCGGTATCCTGCGCGTAGTACAAA
GTTATACCCATCAAAGGTGTATCGCGATCAAAGTGAACGCTTGGTACTCG
GTATCTGGTTGTTGGAAGAAGTGGACAAAAGACCGTCGGCAAAAGTTACT
GTTGGTGAGAGCTACAGGGCTTATTAGCCCGGTTAAATAGGAAGAGAGAG
ATTCAGAAGGCCAAACATTATCAAGACCATCCGTACAATATCTGGCGATT
AAGGAGGAGAAGGAAGCCGCTGTCTTCGAGATCAGACTAGATCGCCCTCC
TGGATTATGGGCATATCGGAGGAAATCAAGCTGGAGGAACTACCGCAAGA
AGCCAAGCTAGCGCACCCGGATGCCGTAGTGCTGGTGGATCGTGCCCCAG
GATCGTCGGCCGCCTCCGCCGGCGCAGCGCTGACGGTTTCGATGTCGGTC
TCGGGCGGAGCGCCCAGTGGAGCAAGTGGGGCCAGTGGCGGCACCAATAG
CCCCGTTTCGGATGGAAACAGCGACTGCGAAGCGGACGAGTACGCCCCGA
AGCGGAAGCAGCGGCGCTATCGCACAACCTTCACCAGCTTTCAGCTCGAG
GAGCTGGAGAAGGCATTCTCGCGGACCCATTATCCCGACGTGTTTACGAG
AGAGGAGCTGGCGATGAAAATTGGATTAACCGAGGCGCGCATTCAGGTTT
GGTTTCAAAATCGGCGCGCCAAGTGGCGCAAGCAGGAGAAGGTTGGCCCC
CAGTCGCATCCGTATAATCCCTACCTGCCCGGCGGCGCCGCCACCATGCA
GACGGTAGTTGGGGCCGCCCTACCGCCCAATCCCTTCACTCACCTGGGCT
TCCAGCTGCGCAAGCCCTTCGACGCCCAACATGCCGCGAACCTTGCCGCC
TTCCGCTACCCGCACCTCTCTGCGGCCCCCATGATTCCGTCGGGCTACTT
TAACCAATTCCAGAGGGCTCCTCCCCATATGTTACCACATGGAATGGCTG
GTATGTACTCTCCCTCGAGCTCATTTCAATCCTTGCTGGCCAATATGACG
GCCGTTCCGCGCGGGACTCCACTTGGAAAACCTCCTGCACTACTGGTGGG
ATCTCCCGATCTGCATTCGCCCAACCACATGCTCGCCTCACCACCCACAT
CGCCTGCCTCCGGGCACGCCTCCCAGCATCAACAACATCCAACCGCTCAC
CCCCCGCCACCTCAGGCGCCTCCTCAAATGCCAGTTGGAGTCCAGCCTGC
TCAGCTTTCTCCCCAGCATCTGGTTGGGATCGCCTTGACCCAACAGGCCT
CGAGTCTATCGCCCACCCAGACTTCCCCGGTGGCCCTGACTTTGTCGCAC
TCTCCCCAACGACAACTGCCTCCACCATCGCATCAGGCTCCGCCGCCACC
TCCCAGAGCTGCAACGCCACCCGAGGACAGGCGCACCTCCTCCATTGCCG
CACTGCGTCTGAAGGCGAGAGAGCACGAACTGAAACTGGAACTGTTGCGT
CAGAATGGACATGGAAACGATGTGGTCAGCTAGCTGGTGGAGCAATTAAG
GTTCAAGGATGCAATGGACGATACGAAGGTCAGCGAGGATTCCCCAAACC
CAAGTGCAAAAAGATTTCCAATTCACTGCAGTCCTAAACTAATAAGTTAT
TCAATTGTATTTACCTAAGCTCCAATTTTAAATAAATTCAATAAGTAAAA
TTAAAAGAAAAAAAAAAAAAAAA

RE68460.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
al-RA 1943 al-RA 63..1865 1..1803 9015 100 Plus
Pph13-RA 1942 Pph13-RA 637..779 699..841 265 79 Plus
Vsx1-RA 3352 Vsx1-RA 1480..1640 671..831 235 76.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 386718..387457 1064..1803 3670 99.7 Plus
chr2L 23010047 chr2L 384528..384913 365..750 1930 100 Plus
chr2L 23010047 chr2L 378135..378500 1..366 1830 100 Plus
chr2L 23010047 chr2L 386322..386594 794..1066 1365 100 Plus
chr2L 23010047 chr2L 385718..385767 749..798 250 100 Plus
chr2L 23010047 chr2L 578185..578327 699..841 250 78.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
al-RA 1227 CG3935-PA 1..1227 407..1633 6135 100 Plus
Pph13-RA 1074 CG2819-PA 68..210 699..841 265 79 Plus
CG34340-RF 1764 CG34340-PF 147..327 652..832 245 75.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:12:39 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
al-RA 1806 CG3935-RA 5..1806 1..1802 9010 100 Plus
Pph13-RA 1880 CG2819-RA 575..717 699..841 265 79 Plus
CG34340-RF 2989 CG34340-RF 736..916 652..832 245 75.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
al-PA 408 CG3935-PA 1..408 407..1630 1642 100 Plus
Rx-PB 904 CG10052-PB 541..779 605..1261 305 36.8 Plus
Pph13-PA 357 CG2819-PA 2..72 635..847 300 77.5 Plus
hbn-PA 409 CG33152-PA 139..346 617..1261 292 36.8 Plus
otp-PJ 374 CG10036-PJ 95..176 596..841 277 59.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 386701..387440 1064..1803 3700 100 Plus
2L 23513712 2L 384509..384894 365..750 1930 100 Plus
2L 23513712 2L 378116..378481 1..366 1830 100 Plus
2L 23513712 2L 386305..386577 794..1066 1365 100 Plus
2L 23513712 2L 578181..578323 699..841 265 79 Plus
2L 23513712 2L 385699..385748 749..798 250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 386701..387440 1064..1803 3700 100 Plus
2L 23513712 2L 384509..384894 365..750 1930 100 Plus
2L 23513712 2L 378116..378481 1..366 1830 100 Plus
2L 23513712 2L 386305..386577 794..1066 1365 100 Plus
2L 23513712 2L 578181..578323 699..841 265 79 Plus
2L 23513712 2L 385699..385748 749..798 250 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:40:31 has no hits.

RE68460.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:36:30 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 386720..387459 1066..1807 99   Plus
chr2L 386325..386593 797..1065 100 -> Plus
chr2L 385720..385765 751..796 100 -> Plus
chr2L 384530..384913 367..750 100 -> Plus
chr2L 378135..378500 1..366 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:33:24 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1227 407..1633 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:42 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1227 407..1633 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:14 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1227 407..1633 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:16:11 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1227 407..1633 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:36:30 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1227 407..1633 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:53:42 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1802 1..1802 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:42 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1802 1..1802 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:14 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 5..1806 1..1802 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:16:12 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1802 1..1802 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:36:30 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 5..1806 1..1802 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:36:30 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
2L 386703..387442 1066..1807 99   Plus
2L 386308..386576 797..1065 100 -> Plus
2L 385701..385746 751..796 100 -> Plus
2L 384511..384894 367..750 100 -> Plus
2L 378116..378481 1..366 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:14 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 386703..387442 1066..1807 99   Plus
arm_2L 386308..386576 797..1065 100 -> Plus
arm_2L 385701..385746 751..796 100 -> Plus
arm_2L 384511..384894 367..750 100 -> Plus
arm_2L 378116..378481 1..366 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:26 Download gff for RE68460.complete
Subject Subject Range Query Range Percent Splice Strand
2L 386703..387442 1066..1807 99   Plus
2L 386308..386576 797..1065 100 -> Plus
2L 385701..385746 751..796 100 -> Plus
2L 384511..384894 367..750 100 -> Plus
2L 378116..378481 1..366 100 -> Plus

RE68460.pep Sequence

Translation from 406 to 1632

> RE68460.pep
MGISEEIKLEELPQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSG
GAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEEL
EKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQS
HPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFR
YPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAV
PRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPP
PPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSP
QRQLPPPSHQAPPPPPRAATPPEDRRTSSIAALRLKAREHELKLELLRQN
GHGNDVVS*

RE68460.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 20:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20646-PA 405 GF20646-PA 1..405 1..408 1553 86.7 Plus
Dana\GF15026-PA 325 GF15026-PA 2..67 82..147 325 81.8 Plus
Dana\GF15246-PA 589 GF15246-PA 44..113 77..146 310 77.1 Plus
Dana\GF23439-PA 613 GF23439-PA 177..272 52..143 293 60.4 Plus
Dana\GF21877-PA 545 GF21877-PA 240..329 63..149 290 60 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 20:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24714-PA 416 GG24714-PA 1..416 1..408 1713 96.6 Plus
Dere\GG24732-PA 352 GG24732-PA 2..73 82..153 331 76.4 Plus
Dere\GG22067-PA 898 GG22067-PA 535..613 67..145 309 62 Plus
Dere\GG10275-PA 614 GG10275-PA 134..271 26..143 288 50 Plus
Dere\GG19984-PA 219 GG19984-PA 107..171 81..145 273 73.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11220-PA 376 GH11220-PA 1..376 1..408 1379 73.8 Plus
Dgri\GH11036-PA 372 GH11036-PA 2..67 82..147 327 81.8 Plus
Dgri\GH11236-PA 372 GH11236-PA 2..67 82..147 327 81.8 Plus
Dgri\GH22006-PA 879 GH22006-PA 526..604 67..145 311 63.3 Plus
Dgri\GH20193-PA 219 GH20193-PA 92..173 71..145 280 64.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 20:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
al-PA 408 CG3935-PA 1..408 1..408 2146 100 Plus
Rx-PB 904 CG10052-PB 541..892 67..390 375 33.5 Plus
otp-PK 416 CG10036-PK 69..392 38..335 321 30.3 Plus
otp-PJ 374 CG10036-PJ 69..350 38..335 319 32.3 Plus
hbn-PA 409 CG33152-PA 139..364 71..306 312 35.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 20:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21624-PA 397 GI21624-PA 1..397 1..408 1353 72 Plus
Dmoj\GI21809-PA 392 GI21809-PA 2..69 82..149 327 79.4 Plus
Dmoj\GI23866-PA 623 GI23866-PA 61..130 77..146 309 77.1 Plus
Dmoj\GI19710-PA 884 GI19710-PA 535..613 67..145 307 62 Plus
Dmoj\GI14821-PA 617 GI14821-PA 166..261 49..143 293 59.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 20:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18872-PA 397 GL18872-PA 1..397 1..408 1513 79.8 Plus
Dper\GL18888-PA 376 GL18888-PA 2..73 82..153 330 76.4 Plus
Dper\GL17060-PA 920 GL17060-PA 499..620 29..145 312 48.4 Plus
Dper\GL18665-PA 370 GL18665-PA 44..113 77..146 302 77.1 Plus
Dper\GL10922-PA 216 GL10922-PA 106..170 81..145 276 73.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 20:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17785-PA 395 GA17785-PA 1..395 1..408 1514 79.8 Plus
Dpse\GA15474-PA 376 GA15474-PA 2..73 82..153 330 76.4 Plus
Dpse\GA10035-PA 921 GA10035-PA 500..621 29..145 315 49.2 Plus
Dpse\GA17327-PA 404 GA17327-PA 143..210 83..150 282 70.6 Plus
Dpse\GA10822-PA 216 GA10822-PA 106..170 81..145 276 73.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 20:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16736-PA 410 GM16736-PA 1..410 1..408 1814 98.8 Plus
Dsec\GM16755-PA 348 GM16755-PA 2..73 82..153 331 76.4 Plus
Dsec\GM15784-PA 895 GM15784-PA 532..610 67..145 309 62 Plus
Dsec\GM26340-PA 613 GM26340-PA 155..271 40..143 291 53.8 Plus
Dsec\GM15498-PA 220 GM15498-PA 108..172 81..145 273 73.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 20:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23020-PA 410 GD23020-PA 1..410 1..408 1814 98.8 Plus
Dsim\GD23036-PA 355 GD23036-PA 2..78 77..153 334 72.7 Plus
Dsim\GD11547-PA 903 GD11547-PA 540..618 67..145 307 62 Plus
Dsim\GD22133-PA 613 GD22133-PA 155..271 40..143 292 53.8 Plus
Dsim\GD25001-PA 220 GD25001-PA 108..172 81..145 273 73.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 20:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17771-PA 381 GJ17771-PA 1..381 1..408 1375 73.5 Plus
Dvir\GJ17788-PA 378 GJ17788-PA 2..67 82..147 326 81.8 Plus
Dvir\GJ17468-PA 881 GJ17468-PA 525..603 67..145 310 63.3 Plus
Dvir\GJ18584-PA 405 GJ18584-PA 153..220 83..150 282 70.6 Plus
Dvir\GJ20457-PA 216 GJ20457-PA 100..170 75..145 278 69 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 20:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23788-PA 375 GK23788-PA 1..375 1..408 1542 78.6 Plus
Dwil\GK24418-PA 364 GK24418-PA 2..66 82..146 321 81.5 Plus
Dwil\GK23335-PA 937 GK23335-PA 577..655 67..145 308 62 Plus
Dwil\GK13702-PA 951 GK13702-PA 499..590 56..146 286 58.7 Plus
Dwil\GK22873-PA 395 GK22873-PA 127..206 71..150 284 61.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 20:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16769-PA 410 GE16769-PA 1..410 1..408 1762 95.4 Plus
Dyak\GE16946-PA 353 GE16946-PA 2..73 82..153 328 76.4 Plus
Dyak\GE12148-PA 906 GE12148-PA 543..621 67..145 310 62 Plus
Dyak\GE12435-PA 612 GE12435-PA 155..271 40..143 291 53 Plus
Dyak\GE11517-PA 219 GE11517-PA 107..171 81..145 273 73.8 Plus

RE68460.hyp Sequence

Translation from 406 to 1632

> RE68460.hyp
MGISEEIKLEELPQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSG
GAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEEL
EKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQS
HPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFR
YPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAV
PRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPP
PPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSP
QRQLPPPSHQAPPPPPRAATPPEDRRTSSIAALRLKAREHELKLELLRQN
GHGNDVVS*

RE68460.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
al-PA 408 CG3935-PA 1..408 1..408 2146 100 Plus
Rx-PB 904 CG10052-PB 541..892 67..390 375 33.5 Plus
otp-PK 416 CG10036-PK 69..392 38..335 321 30.3 Plus
otp-PJ 374 CG10036-PJ 69..350 38..335 319 32.3 Plus
hbn-PA 409 CG33152-PA 139..364 71..306 312 35.6 Plus