Clone RE69123 Report

Search the DGRC for RE69123

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:691
Well:23
Vector:pFlc-1
Associated Gene/Transcriptfax-RD
Protein status:RE69123.pep: gold
Sequenced Size:2505

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
fax-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

RE69123.complete Sequence

2505 bp assembled on 2009-08-15

GenBank Submission: BT099606.1

> RE69123.complete
ACTCTCTCGCCGATTCTCTCTCGGCTCTGGCGGACAACCACACCCTGCCT
CTCCCTTTTTTGGCAGAGGGCGCGAAAGCATAAAATATGCCAACGGTTGG
CTCTTTGTTATGGCCCTCAATGTCGATCATAAGATGCGTTTCCGCTCCAA
GAAGGGTCAGCTGCCGTTCATCGAGCTGAATGGGGAGGAAATCGCCGATT
CGGCCATCATCATCAAGGAACTGTCGTCCAAATACGAGAAGTACCTGGAC
TCGGGACTCACCGCCGAGCAAAGGAATGTCTCGTACGCCACGATTGCCAT
GCTGGAGAACCATCTCATCTGGATCATCTTCTACTGGCGCGCCAAGTATC
CGGACAATGTGCTCAAGGGCTACAAGGTCAACTTGCAGCACGCCCTCGGC
CTGCGGCTGCCCAACTCGATTCTGAACTTCTTCTTTAAGATCACCTTTGG
TCGCAAGGGCACGAAGAAGCTGAAGGCGCACGGCATCGGTGTCCACAGCG
CCGAGGAGATCGAGGAGTTCGGCAAGGACGACCTGAAGGTGCTCAGCGAG
ATGCTCGACTGCAAGCCTTTCTTCTTCGGCGACGAGCCCACCACCCTGGA
TGTGGTGGCCTTCGCTGTCCTCTCGCAGCTCCACTATCTGTCCAAGGACA
TTGCGTATCCGCTGCGCGACTACATGACCGAGAAGTGCCCCAACTTGATT
GGCCACGTATCTCGCATGAAGGACAAGTGCTTCCCCGACTGGGACGAGAT
CTGCACGAAGCTGGACCTCAATGCGCACATTCCCAAGCCAGAGCCCGAGA
CCAAGGAGGGCAAGGAGGGTGGCGAGCAGGAGAAATCAAACGAACAGGAG
GGCACTGAGGGCGACAAGATCGAGAAGGAGTTGGAGAAGGACAAGTCAAA
CGAGAAGGAGTCGACCGAGGAGAACAAAGAGAAGGAGGAAACAAAGTAAA
TTCGCCGTTAGTTATATGCGTACATATATCTAGTATATGTGTATGATCGA
AGGAAACAGAAACACCCACATACACACACATTATATATATATACATATGT
AGTACGATACTATATAGTAAGGCCCTATATAGCTAGGCGCTACGCTCTCA
TATATAAGCATTCAGACATCAGAAAACCACTCGAAAAACAAAAACGAAAA
AAAACATCAAGAACACCCATTTACAAACCTAGGACAACTGTAAAGCAAAA
GCAGGCAAAAACCATCAGCAAGAGAACGATCCACTAAGTAATGAGAAAAA
AAACAAAAAGCATATACAATAACGTAACGTAAAACTTTGGACATCTTTTT
TTATATATTTACATGACGACGTTTGTATTACAAGAACAAGAAACAAAAAG
CAAAAAAAAGTGAAGAAAACGTAAAAAAAAAACCGTAAAAACCATTTAGT
ATAAAATTATAAAAGTTTATACGTATAAATATTAAGACGATGAATGAAAG
CGATGAGAGCGGGGGGAGAAATTATAAAAAATTAGTTAAAGAACGCGAAT
AAAACAAAGAACAAGTGAGCAAAACGTGAGTAAAAAGAGTGAAGCCAGAT
AGGACGAAAAGTTAGCGAGGTGTAGAACAGCATTCAATACGCATTAATCA
TTAGTTTTCATTCAAAAGCGATCTATATAATACACTCATCGACACTCACA
CTCACTCTCACACACACTCAACAAAAAACACAACACAAAACAACACACTC
TACACACATATAGCATATGCAGCAACAATTGCAACTCGATGGTATTGTTT
ACTCTTCCAAAATTGATTAAGCTTAAAGTAACGAAAGTAACGAAAGGAAC
CGCTACCAGTACGATAGGAAGATACGATAGTGATGGTTAGTAGGGATGGC
ATGCAATGGGGATGAGAATGCAAATGCAAATGCGAATGCGAATGGTATAG
GAATGATATAACGGAATGACGGCAATTAAGTTTATTTTTTATATATATAT
GATTGCAAATAGTAATTTTGATTCTCGTGTGCAAATAATTAAACAAAATG
GATAAAATTTATTACTTATAATTATATACATAAACATTATATACGCCCAT
TATGCATAAAGATGTGTATAAAAAAAAACAAAGCAAAACAAAACAAAACA
AAAACGACAAAGCATAAAAACTGTATGTTGGTTCTTTTATTATATTATAC
TTTATTTCTATAAATATTATTGTAATTGTACTGTGTATTATGATTTTGCT
AACCAAAATCCCTTAGTATGAGATGCTCATCGATATTTCACCCCCATACA
CAAAATCAAATCAATTCGAACCAAAAAGAATACTCGGCCATCCAAACGAA
CAAAATTTACCATTTATTTTGTACGCAATTGTAACTACTTTTATATGTAT
GTACATATGTATGTACATTCTCTATTTTGGTACGTCCACTGAAACAAAAT
TATAGTACGCCTCATTTGATTTTTCAACTGTCTTGTGTTTCATACGATTT
AATTTAATGATATTGATTATGCAAATATATATATAAATATAAAAAAAAAA
AAAAA

RE69123.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:09
Subject Length Description Subject Range Query Range Score Percent Strand
fax-RD 2779 fax-RD 1..2491 1..2493 12385 99.9 Plus
fax-RB 2788 fax-RB 465..2500 456..2493 10110 99.9 Plus
fax-RA 3809 fax-RA 1485..3520 456..2493 10110 99.9 Plus
fax-RB 2788 fax-RB 1..457 1..457 2285 100 Plus
fax-RA 3809 fax-RA 1139..1477 119..457 1695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16393360..16394954 2490..894 7760 99.6 Minus
chr3L 24539361 chr3L 16395283..16395620 793..456 1690 100 Minus
chr3L 24539361 chr3L 16396803..16397142 458..119 1670 99.4 Minus
chr3L 24539361 chr3L 16398111..16398228 118..1 590 100 Minus
chr3L 24539361 chr3L 16395108..16395210 895..793 515 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
fax-RD 840 CG4609-PD 1..840 110..949 4200 100 Plus
fax-RC 1248 CG4609-PC 418..1248 119..949 4155 100 Plus
fax-RE 816 CG4609-PE 1..816 134..949 4080 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:13:09 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
fax-RD 3274 CG4609-RD 5..2492 1..2490 12350 99.9 Plus
fax-RB 3283 CG4609-RB 5..2501 1..2490 12225 99.6 Plus
fax-RE 3209 CG4609-RE 58..2427 119..2490 11760 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
fax-PD 279 CG4609-PD 1..258 110..883 1209 100 Plus
fax-PC 415 CG4609-PC 130..394 98..883 1200 97.4 Plus
fax-PB 282 CG4609-PB 1..261 110..883 1195 98.9 Plus
fax-PA 418 CG4609-PA 130..397 98..883 1186 96.3 Plus
fax-PE 271 CG4609-PE 1..250 134..883 1167 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16403575..16405172 2493..894 7900 99.9 Minus
3L 28110227 3L 16407020..16407359 458..119 1700 100 Minus
3L 28110227 3L 16405501..16405838 793..456 1690 100 Minus
3L 28110227 3L 16408328..16408445 118..1 590 100 Minus
3L 28110227 3L 16405326..16405428 895..793 515 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16396675..16398272 2493..894 7920 99.8 Minus
3L 28103327 3L 16400120..16400459 458..119 1700 100 Minus
3L 28103327 3L 16398601..16398938 793..456 1690 100 Minus
3L 28103327 3L 16401428..16401545 118..1 590 100 Minus
3L 28103327 3L 16398426..16398528 895..793 515 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:10:59 has no hits.

RE69123.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:04:25 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16398111..16398228 1..118 100   Minus
chr3L 16396804..16397142 119..457 99 <- Minus
chr3L 16395284..16395618 458..792 100 <- Minus
chr3L 16395108..16395210 793..895 100 <- Minus
chr3L 16393360..16394952 896..2490 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:22 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 1..840 110..949 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:59:12 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 1..840 110..949 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:30:14 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 1..840 110..949 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:04:25 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 1..840 110..949 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-15 14:26:56 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 1..2488 1..2490 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:59:11 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 1..2488 1..2490 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:30:14 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 1..2488 1..2490 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:04:25 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
fax-RD 5..2492 1..2490 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:04:25 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16408328..16408445 1..118 100   Minus
3L 16407021..16407359 119..457 100 <- Minus
3L 16405502..16405836 458..792 100 <- Minus
3L 16405326..16405428 793..895 100 <- Minus
3L 16403578..16405170 896..2490 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:30:14 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16401428..16401545 1..118 100   Minus
arm_3L 16400121..16400459 119..457 100 <- Minus
arm_3L 16398602..16398936 458..792 100 <- Minus
arm_3L 16398426..16398528 793..895 100 <- Minus
arm_3L 16396678..16398270 896..2490 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:55 Download gff for RE69123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16401428..16401545 1..118 100   Minus
3L 16400121..16400459 119..457 100 <- Minus
3L 16398602..16398936 458..792 100 <- Minus
3L 16398426..16398528 793..895 100 <- Minus
3L 16396678..16398270 896..2490 99 <- Minus

RE69123.hyp Sequence

Translation from 0 to 948

> RE69123.hyp
LSRRFSLGSGGQPHPASPFFGRGRESIKYANGWLFVMALNVDHKMRFRSK
KGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAM
LENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFG
RKGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLD
VVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEI
CTKLDLNAHIPKPEPETKEGKEGGEQEKSNEQEGTEGDKIEKELEKDKSN
EKESTEENKEKEETK*

RE69123.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
fax-PD 279 CG4609-PD 1..279 37..315 1469 100 Plus
fax-PC 415 CG4609-PC 130..415 33..315 1460 97.6 Plus
fax-PB 282 CG4609-PB 1..282 37..315 1455 98.9 Plus
fax-PA 418 CG4609-PA 130..418 33..315 1446 96.5 Plus
fax-PE 271 CG4609-PE 1..271 45..315 1427 100 Plus

RE69123.pep Sequence

Translation from 1 to 948

> RE69123.pep
LSRRFSLGSGGQPHPASPFFGRGRESIKYANGWLFVMALNVDHKMRFRSK
KGQLPFIELNGEEIADSAIIIKELSSKYEKYLDSGLTAEQRNVSYATIAM
LENHLIWIIFYWRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFG
RKGTKKLKAHGIGVHSAEEIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLD
VVAFAVLSQLHYLSKDIAYPLRDYMTEKCPNLIGHVSRMKDKCFPDWDEI
CTKLDLNAHIPKPEPETKEGKEGGEQEKSNEQEGTEGDKIEKELEKDKSN
EKESTEENKEKEETK*

RE69123.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 04:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10211-PA 415 GF10211-PA 127..400 33..300 1369 94.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 04:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13452-PA 418 GG13452-PA 130..403 33..300 1379 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 04:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15590-PA 441 GH15590-PA 153..426 33..300 1358 93.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 04:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
fax-PD 279 CG4609-PD 1..279 37..315 1469 100 Plus
fax-PC 415 CG4609-PC 130..415 33..315 1460 97.6 Plus
fax-PB 282 CG4609-PB 1..282 37..315 1455 98.9 Plus
fax-PA 418 CG4609-PA 130..418 33..315 1446 96.5 Plus
fax-PE 271 CG4609-PE 1..271 45..315 1427 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 04:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16867-PA 426 GI16867-PA 138..411 33..300 1358 94.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 04:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17995-PA 419 GL17995-PA 134..404 33..300 1385 96.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 04:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18298-PA 419 GA18298-PA 134..404 33..300 1385 96.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 04:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24402-PA 415 GM24402-PA 130..400 33..300 1406 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 04:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12471-PA 415 GD12471-PA 130..400 33..300 1408 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 04:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\fax-PA 425 GJ12617-PA 137..410 33..300 1364 94.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 04:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17490-PA 434 GK17490-PA 146..419 33..300 1370 94.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 04:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22555-PA 418 GE22555-PA 130..403 33..300 1378 95.6 Plus