Clone RE70003 Report

Search the DGRC for RE70003

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:700
Well:3
Vector:pFlc-1
Associated Gene/Transcriptfwe-RC
Protein status:RE70003.pep: gold
Sequenced Size:2380

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6151-RC 2010-01-14 Manual selection by Sue Celniker

Clone Sequence Records

RE70003.complete Sequence

2380 bp assembled on 2010-07-15

GenBank Submission: BT125064.1

> RE70003.complete
AGGTTTTTTTCGTTCCGTGTGACGTGAAAAGTGCAAATAGTAATTGTTCG
AATTAGTTTAAGCCTAGCTAACTAACTAAATAAATAGCCATGTCGTTTGC
GGAAAAGATAACGGGTCTGCTGGCACGGCCGAATCAACAAGATCCAATTG
GACCGGAGCAGCCGTGGTATCTCAAATATGGAAGTCGATTGCTGGGCATT
GTGGCCGCCTTCTTTGCCATTCTTTTCGGCCTGTGGAATGTGTTCTCCAT
CATCACGCTCAGCGTATCCTGCCTGGTGGCTGGCATCCTTCAAATGGTGG
CAGGATTTGTGGTGATGCTCTTGGAGGCTCCCTGCTGTTTCGTCTGCTTT
GGGCAGGTGAACGAGATCGCGGAAAAGGTGGAATCTAAGCCCTTGTACTT
CCGTGCCGGGCTCTACATTGCCATGGCCATTCCGCCCATTATTCTGTGCT
TTGGACTGGCCAGCTTATTCGGCAGTGGGCTGATCTTTGGCACTGGCGTG
GTTTACGGCATGATGGCGTTAGGCAAGAACAAGCATATATTTTTAGTGAG
AAACTATATTTGAAAGCTAACCGAATGCAAGAGGAACCGGAACCTATAAG
TTAACCACAGCTTCCACACACTCACACACAGCTAATGCTAATGGAAAGCC
ACTGATGATATGGACAAGTGAATGTCGAGAACCTAGAGCAATATGTACAA
CTCAGAAATAATTAACTTTATATGCTTTGCTTCGATGTAAACCATAAAAT
TAAATGTTAAACGTTATTTGAGAATCGATTTGCTCGCGGGATAGTCACAA
TTTGAAATTGAACATAATCAAGCATACAGATAGAATATATATATATATAT
ATATATACAACAAGTTGAGAATTTACCAGTTATATTTTTTAAATGTTGTA
ACCGAAAAGTGTCCATTTCAATTTGATGCATTGTTAGACGGTTTTCTTTT
TAGACAATTACTTGGTTAATAGGATTTCGTTTTCGGGTTTCGTATGATTT
CTTGTTTGCTAGAAGTATATGCTTATTTTTTTTAGTATACCTAAGTTATT
TATAAGAGTTTATTCCAATCGTTTAACTTTGAAAGTCTGAGAAAAACGTT
TTAAATTATTTTTGTTGTTGCCTATTGGCATTCTTACCACAGAAGCATTC
CAAAATCTGTTTACTTTACGCATAAGTTATTGTATAGTTTAATTATTATA
ACTTTAAATATACATTATTTACAAGAAACTCGCGATAATTTATTACAATT
TAGCCTTCGCCAGCAACTAAGAGTCTCACCTAAAGTAATCACGAATCATA
ATTAATTTGTTGAACTTTGTTAATCAATGAACGCAACACTAAAAATGAAA
ACATAAACATGTAAAATATTTCGTTAGAATTTGAACGCGCATGATTCAAA
TATCAAACACTTTGTACATGCCACCTGAAAACTGTCCAAAATCCTGCCGT
TAAAGCCAAGTACATTCAACGACGGCCAACAGCGAGTAACAACAATATAC
GATTTACGTTAACGAGTTCTGAACTTTGCTGCGTCCAAGAGATCACTACA
GAGCATCCGCCGAGGACATGCGGGCAGCTGCTCAGCAAACCTTCGGAGGA
AACACACCTGCCCAAACCAACGATCGAGCGGGGATTGTGAACAACGCCCA
GCCCTTCTCCTTCACCGGTGCCGTGGGCACGGACAGCAATGTGTGATTCA
GAAGCTAGCTGATCGGGATTTCGAGGAATCGAAGAGCTGGGTGTGCCGTG
AGAAAACAAGACTCAAAACGCAACATTTGAAGGGCAAACCTAACCAAGAG
AACATCGGCAGGCAATCATAAACATAATCATGTGCAATTTCTGATTGTTC
AATAACCAACGCAAATGGATAACAAAAGTTTTTAAATCCGATTAGCTCTG
ATCTCTTTCTAGAGCAATCCAAATTACTCGATCAGAAAGAAGTCACCCAA
AACAAGATCATTAAATTTTAAACCATTTTTGTATTAAATGTATGTAAATG
TATATTGGTTTTAAAAGCGTTTTGCGTTTTCTGTATCCTATTAATTAATT
GTGTTGCCTGTGTCCCATCATTCCAAAACATTTGGTTTCAACTAAGTAGA
AATTGCAAATAAATTATTGAACGACATCACTAGCGAGGTGAAAAAAAAGA
TCATGTAAAATTTATGTTTAGTCATAGTTTAAATATACCTTAAATATATT
TAAATGCATAATACTAAAATGTTTAAATTAATGCAAATAACACTATAAAT
ATTGTATGTAAACCATATTAAAATTGAATTAAAGATACTTTAAATTATGT
TAAATAAAATTAATTATACAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAGAAAAAAAAAAAAAAAA

RE70003.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6151.b 899 CG6151.b 61..899 4..842 4195 100 Plus
CG6151-RA 1343 CG6151-RA 608..1343 1552..2287 3665 99.8 Plus
CG6151-RA 1343 CG6151-RA 82..607 4..529 2630 100 Plus
CG6151.c 1643 CG6151.c 82..607 4..529 2630 100 Plus
CG6151.c 1643 CG6151.c 1264..1643 530..909 1900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15801044..15802065 1551..530 5095 99.9 Minus
chr3L 24539361 chr3L 15799902..15800676 2322..1548 3845 99.7 Minus
chr3L 24539361 chr3L 15803243..15803450 421..214 1040 100 Minus
chr3L 24539361 chr3L 15805760..15805881 213..92 610 100 Minus
chr3L 24539361 chr3L 15803070..15803177 529..422 540 100 Minus
chr3L 24539361 chr3L 15806098..15806186 92..4 445 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-RC 474 CG6151-PC 1..474 90..563 2370 100 Plus
fwe-RA 585 CG6151-PA 1..440 90..529 2200 100 Plus
fwe-RB 579 CG6151-PB 1..440 90..529 2200 100 Plus
fwe-RA 585 CG6151-PA 441..585 1552..1696 725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-RC 2364 CG6151-RC 49..2364 4..2319 11550 99.9 Plus
fwe-RB 3020 CG6151-RB 1231..3020 530..2319 8920 99.9 Plus
fwe-RA 1342 CG6151-RA 575..1342 1552..2319 3825 99.9 Plus
fwe-RB 3020 CG6151-RB 49..574 4..529 2630 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-PC 157 CG6151-PC 1..157 90..560 813 100 Plus
fwe-PB 192 CG6151-PB 1..146 90..527 754 100 Plus
fwe-PA 194 CG6151-PA 1..146 90..527 754 100 Plus
fwe-PA 194 CG6151-PA 147..194 1550..1693 241 97.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15811220..15812241 1551..530 5095 99.9 Minus
3L 28110227 3L 15810078..15810852 2322..1548 3860 99.9 Minus
3L 28110227 3L 15813419..15813626 421..214 1040 100 Minus
3L 28110227 3L 15815936..15816057 213..92 610 100 Minus
3L 28110227 3L 15813246..15813353 529..422 540 100 Minus
3L 28110227 3L 15816274..15816362 92..4 445 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15804320..15805341 1551..530 5095 99.9 Minus
3L 28103327 3L 15803178..15803952 2322..1548 3860 99.8 Minus
3L 28103327 3L 15806519..15806726 421..214 1040 100 Minus
3L 28103327 3L 15809036..15809157 213..92 610 100 Minus
3L 28103327 3L 15806346..15806453 529..422 540 100 Minus
3L 28103327 3L 15809374..15809462 92..4 445 100 Minus
Blast to na_te.dros performed 2014-11-26 19:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 555..717 2054..1890 135 57.7 Minus
baggins 5453 baggins BAGGINS 5453bp 2324..2367 684..641 120 80 Minus
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 531..672 2101..1965 120 58.7 Minus

RE70003.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:11:53 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15806098..15806190 1..92 98   Minus
chr3L 15805760..15805880 93..213 100 <- Minus
chr3L 15803243..15803450 214..421 100 <- Minus
chr3L 15803070..15803177 422..529 100 <- Minus
chr3L 15801044..15802065 530..1551 97 <- Minus
chr3L 15799960..15800672 1552..2264 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-15 11:40:46 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
CG6151-RC 1..474 90..563 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:37:48 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
flower-RC 1..474 90..563 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:46:02 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
fwe-RC 1..474 90..563 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:53 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
fwe-RC 1..474 90..563 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed on 2010-07-15 11:40:46 has no hits.
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:37:48 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
flower-RC 50..2332 1..2282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:46:02 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
fwe-RC 45..2327 1..2282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:53 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
fwe-RC 45..2364 1..2319 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:11:53 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15816274..15816366 1..92 98   Minus
3L 15815936..15816056 93..213 100 <- Minus
3L 15813419..15813626 214..421 100 <- Minus
3L 15813246..15813353 422..529 100 <- Minus
3L 15811220..15812241 530..1551 99 <- Minus
3L 15810081..15810848 1552..2319 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:46:02 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15809374..15809466 1..92 98   Minus
arm_3L 15809036..15809156 93..213 100 <- Minus
arm_3L 15806519..15806726 214..421 100 <- Minus
arm_3L 15806346..15806453 422..529 100 <- Minus
arm_3L 15804320..15805341 530..1551 99 <- Minus
arm_3L 15803181..15803948 1552..2319 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:40:28 Download gff for RE70003.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15809374..15809466 1..92 98   Minus
3L 15809036..15809156 93..213 100 <- Minus
3L 15806519..15806726 214..421 100 <- Minus
3L 15806346..15806453 422..529 100 <- Minus
3L 15804320..15805341 530..1551 99 <- Minus
3L 15803181..15803948 1552..2319 99 <- Minus

RE70003.pep Sequence

Translation from 89 to 562

> RE70003.pep
MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWN
VFSIITLSVSCLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESK
PLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKNKHI
FLVRNYI*

RE70003.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10375-PA 194 GF10375-PA 1..153 2..154 681 83 Plus
Dana\GF20158-PA 194 GF20158-PA 3..149 1..147 675 85 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13520-PA 194 GG13520-PA 1..154 1..154 720 90.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14474-PA 206 GH14474-PA 12..164 2..154 629 78.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-PC 157 CG6151-PC 1..157 1..157 813 100 Plus
fwe-PB 192 CG6151-PB 1..146 1..146 754 100 Plus
fwe-PA 194 CG6151-PA 1..146 1..146 754 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13620-PA 194 GI13620-PA 1..146 2..147 575 75.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24930-PA 226 GL24930-PA 30..183 2..154 658 81.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19394-PA 221 GA19394-PA 30..176 2..147 655 84.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24464-PA 194 GM24464-PA 1..154 1..154 720 91.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12536-PA 194 GD12536-PA 1..154 1..154 723 91.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13956-PA 195 GJ13956-PA 1..147 2..147 623 80.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20652-PA 200 GK20652-PA 1..148 2..147 634 83.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19812-PA 194 GE19812-PA 1..154 1..154 726 91.6 Plus
Dyak\GE19810-PA 91 GE19810-PA 1..41 1..41 225 100 Plus

RE70003.hyp Sequence

Translation from 89 to 562

> RE70003.hyp
MSFAEKITGLLARPNQQDPIGPEQPWYLKYGSRLLGIVAAFFAILFGLWN
VFSIITLSVSCLVAGILQMVAGFVVMLLEAPCCFVCFGQVNEIAEKVESK
PLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKNKHI
FLVRNYI*

RE70003.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
fwe-PC 157 CG6151-PC 1..157 1..157 813 100 Plus
fwe-PB 192 CG6151-PB 1..146 1..146 754 100 Plus
fwe-PA 194 CG6151-PA 1..146 1..146 754 100 Plus