Clone RE70278 Report

Search the DGRC for RE70278

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:702
Well:78
Vector:pFlc-1
Associated Gene/TranscriptCG12304-RA
Protein status:RE70278.pep: gold
Sequenced Size:1126

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12304-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE70278.complete Sequence

1126 bp assembled on 2010-12-06

GenBank Submission: BT125813.1

> RE70278.complete
ATGGGAATTGATAATTTGCGCAGGTTATTGTGTTTATCCAACGATTCTCG
CCGCGAAAATGTACGAACTGAAGACTCTGCTGCCGCAATTCGACATAAAG
CTGCCCACCTGCATGTATCCTCTCAAGAACGTTAGCCTGGCGGCGGATTC
CTTGGCCAGCGGCTCCTCCACATCCGCATCCACATCCGCGTCCACATCAT
CATGCAAATTGGAGGCCAACAGGATCGACAGAACGGGACGAAACGCAGCC
ACATGTGCACTTGATTTGGACTCTTTAGGCCGACAAATACAGCGACTGCT
AAAGGACGATACGGCATCAGTGGCCGCCCGACAGGAGAAGGTTCTCAAGC
AGCTGGAGGAGCTGAAGGCGCAGCTGGGACAAATCCGGGCGGGACTTGGT
GTTTGTGGCAAGACTTTCCAGCACACGACTGCTTTCCAGAATGGTGGATT
AAAGGAGGTGCCACTGCAGGATGTCGTCATCAATGGACATCCCAACTTCA
TACCCTATGCCTTGTTGGCCCTGAAAAATGCCTGGCGCAATCTGTACACT
ATTGATGTCAAGACCTTTACGCACTCTACGATGGCCGACATTGGACCAGC
AGCACGGGAATTCGAGGCCAACTTGGCGAAGGTTCCAGTAAACCCTGCTT
TGCCCAAGATTAGTGTGACGCTCATCTGGAAGAACTGCGAACACACCGAG
ATGATCAGCTCGCCCACCATGTACGTGCCCATCTACGGAGAGGTGAACAT
CATTCGCTATCTGGGCCGTGTGGGTCCAGCCGAGTATCGTTATGAGGGCT
CTCCGCTCTGCAATGAGATCGACCTTGTCCTGGACATTTGCTACCAACTG
CTGCGCTGCAACACGCACAAAACGCAGGTGGCCATGGTGCGCCTGCTGGA
CAAGCGACTGCAGAAGCAGCAGTATTTCGGTGGATCCCAGATGTCGGTGG
CGGATGTCGGTGTCTACAGCTCACTGATACGCATGCCAGCTGTTACCGAG
AAGGATCTGACGCCTGCGCTAGTGGCTTGGAGAAAAAGGGCCAAGCTCGT
GGTTCAAATTTAAATAATTCAATCGACAAAGGCGAACAAATAAATTATAG
AATTCAATGGAAAAAAAAAAAAAAAA

RE70278.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15574852..15575274 687..1109 2085 99.5 Plus
chr3L 24539361 chr3L 15574567..15574798 456..687 1160 100 Plus
chr3L 24539361 chr3L 15573610..15573811 4..205 1010 100 Plus
chr3L 24539361 chr3L 15574214..15574370 303..459 785 100 Plus
chr3L 24539361 chr3L 15573927..15574026 206..305 500 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-RA 1005 CG12304-PA 1..1005 59..1063 5025 100 Plus
CG12304-RB 906 CG12304-PB 148..906 305..1063 3795 100 Plus
CG12304-RB 906 CG12304-PB 1..147 59..205 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-RA 1150 CG12304-RA 43..1148 4..1109 5530 100 Plus
CG12304-RB 1051 CG12304-RB 245..1049 305..1109 4025 100 Plus
CG12304-RB 1051 CG12304-RB 43..244 4..205 1010 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-PA 334 CG12304-PA 1..334 59..1060 1588 100 Plus
CG12304-PB 301 CG12304-PB 1..301 59..1060 1394 84.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15584923..15585345 687..1109 2115 100 Plus
3L 28110227 3L 15584638..15584869 456..687 1160 100 Plus
3L 28110227 3L 15583680..15583881 4..205 1010 100 Plus
3L 28110227 3L 15584285..15584441 303..459 785 100 Plus
3L 28110227 3L 15583997..15584096 206..305 500 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15578023..15578445 687..1109 2115 100 Plus
3L 28103327 3L 15577738..15577969 456..687 1160 100 Plus
3L 28103327 3L 15576780..15576981 4..205 1010 100 Plus
3L 28103327 3L 15577385..15577541 303..459 785 100 Plus
3L 28103327 3L 15577097..15577196 206..305 500 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:31:54 has no hits.

RE70278.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:53:01 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15574852..15575274 687..1110 99   Plus
chr3L 15574569..15574797 458..686 100 -> Plus
chr3L 15574216..15574368 305..457 100 -> Plus
chr3L 15573927..15574025 206..304 100 -> Plus
chr3L 15573607..15573772 1..166 98 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-06 17:16:15 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 1..1005 59..1063 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:33:26 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 1..1005 59..1063 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:53:01 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 1..1005 59..1063 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-06 17:16:15 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 35..1143 1..1110 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:33:26 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 40..1148 1..1110 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:53:01 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RA 40..1148 1..1110 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:53:01 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15584923..15585345 687..1110 99   Plus
3L 15584640..15584868 458..686 100 -> Plus
3L 15584287..15584439 305..457 100 -> Plus
3L 15583997..15584095 206..304 100 -> Plus
3L 15583677..15583881 1..205 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:33:26 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15578023..15578445 687..1110 99   Plus
arm_3L 15577740..15577968 458..686 100 -> Plus
arm_3L 15577387..15577539 305..457 100 -> Plus
arm_3L 15577097..15577195 206..304 100 -> Plus
arm_3L 15576777..15576981 1..205 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:52:07 Download gff for RE70278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15578023..15578445 687..1110 99   Plus
3L 15577740..15577968 458..686 100 -> Plus
3L 15577387..15577539 305..457 100 -> Plus
3L 15577097..15577195 206..304 100 -> Plus
3L 15576777..15576981 1..205 99 -> Plus

RE70278.hyp Sequence

Translation from 0 to 1062

> RE70278.hyp
LELIICAGYCVYPTILAAKMYELKTLLPQFDIKLPTCMYPLKNVSLAADS
LASGSSTSASTSASTSSCKLEANRIDRTGRNAATCALDLDSLGRQIQRLL
KDDTASVAARQEKVLKQLEELKAQLGQIRAGLGVCGKTFQHTTAFQNGGL
KEVPLQDVVINGHPNFIPYALLALKNAWRNLYTIDVKTFTHSTMADIGPA
AREFEANLAKVPVNPALPKISVTLIWKNCEHTEMISSPTMYVPIYGEVNI
IRYLGRVGPAEYRYEGSPLCNEIDLVLDICYQLLRCNTHKTQVAMVRLLD
KRLQKQQYFGGSQMSVADVGVYSSLIRMPAVTEKDLTPALVAWRKRAKLV
VQI*

RE70278.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-PA 334 CG12304-PA 1..334 20..353 1710 100 Plus
CG12304-PB 301 CG12304-PB 1..301 20..353 1503 90.1 Plus

RE70278.pep Sequence

Translation from 1 to 1062

> RE70278.pep
WELIICAGYCVYPTILAAKMYELKTLLPQFDIKLPTCMYPLKNVSLAADS
LASGSSTSASTSASTSSCKLEANRIDRTGRNAATCALDLDSLGRQIQRLL
KDDTASVAARQEKVLKQLEELKAQLGQIRAGLGVCGKTFQHTTAFQNGGL
KEVPLQDVVINGHPNFIPYALLALKNAWRNLYTIDVKTFTHSTMADIGPA
AREFEANLAKVPVNPALPKISVTLIWKNCEHTEMISSPTMYVPIYGEVNI
IRYLGRVGPAEYRYEGSPLCNEIDLVLDICYQLLRCNTHKTQVAMVRLLD
KRLQKQQYFGGSQMSVADVGVYSSLIRMPAVTEKDLTPALVAWRKRAKLV
VQI*

RE70278.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24083-PA 336 GF24083-PA 1..336 20..353 1575 87.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15913-PA 334 GG15913-PA 1..334 20..353 1649 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23308-PA 332 GH23308-PA 1..332 20..353 1425 79.8 Plus
Dgri\GH17081-PA 291 GH17081-PA 1..291 20..353 1291 74.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-PA 334 CG12304-PA 1..334 20..353 1710 100 Plus
CG12304-PB 301 CG12304-PB 1..301 20..353 1503 90.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11682-PA 329 GI11682-PA 1..329 20..353 1360 76 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24943-PA 326 GL24943-PA 1..326 20..353 1477 82.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11544-PA 326 GA11544-PA 1..326 20..353 1475 82.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25545-PA 334 GM25545-PA 1..334 20..353 1766 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14558-PA 334 GD14558-PA 1..334 20..353 1658 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11354-PA 329 GJ11354-PA 1..329 20..353 1411 79.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20455-PA 340 GK20455-PA 1..340 20..353 1422 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:37:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22257-PA 334 GE22257-PA 1..334 20..353 1649 96.4 Plus
Dyak\GE19834-PA 544 GE19834-PA 1..296 20..315 1465 97.6 Plus