Clone RE72348 Report

Search the DGRC for RE72348

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:723
Well:48
Vector:pFlc-1
Associated Gene/Transcriptl(2)05714-RB
Protein status:RE72348.pep: gold
Sequenced Size:979

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
l(2)05714-RB 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE72348.complete Sequence

979 bp assembled on 2010-12-06

GenBank Submission: BT125806.1

> RE72348.complete
GCTTTTGGCGCTCATCTTTCAAAGAATACTTTTCCACAAATCAGACAAGC
TTCATCCGAAAGCGGGCACAATGCTGAAGGGTTACAAGACGGATGAGGAC
AAGAAGGTGAAGCGACTGTACCACCAACGCTATCGCACAGAGTGGGAGAA
ATATCCGGAGCTCTCCAGCTGGCTGGCGTCTAGTAATGACGGTTACTCGG
CGCACTGCAAGATCTGCGACATCAATGTCCTCGCCAGACTAGCGTCCATC
AAGCAGCACCTCGCAACGCGGAAACACCAGGAAAGTTTCAAGTACCACAA
CATTCTTGCCAAGAATATGATTAAGGGTGAACTTGTCAAAGATGAGCATG
ACCCAGACTTGGAGGCCTCCATAATTTCACCCAAAGCAAAGCCCAAAGCC
AAATCAAAGACCTATCCAAGGCAAAAGCCAAGGAGCAAAATGCAGCCAAA
GATCAAGAACGACACGAAGGTGGAGAGCATGGAGGAGGAGACGGAGGAGG
ACGAAATCGCCTCGAACGACTCAATCCTGGATGATTTACTCAGAACAGAT
CAGCCCTATCAAGAGCAAGAATTTGAGGTTGAGAACGAGTTCCTCGAAGT
ACAACAGAATGAAACAGATCTCCAGGACCAAGAGGTGGTCTACGAGGAAG
AGATGATACAGCTCAAGCCGGAAGATACGGAGATTAATAACGAATACCAA
GTCGACGCGATGACGGAAGACACCATTATTAGTGAATTTGACTTGTTTGG
CAAGAGTTTGGCTCTGCAGCTGAACAACATGGACCTGGAGGACGCACTAA
TGTGCCAGGAGCGTCTGCAGGTGGTCCTAACGGAATTTCGCCTGAAGGTG
CTCAAGCGCAAGAGAGAGCAAGCACGATCTTCGTAGGCTTACAATTTATA
TCAAGCTGTCTTATGTACATAATATAATTTCTTTAACAACTAAATAAATA
ACTATTCTGCCGCAAAAAAAAAAAAAAAA

RE72348.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4969237..4969886 961..312 3250 100 Minus
chr2L 23010047 chr2L 4970154..4970466 313..1 1565 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-RB 816 CG8886-PB 1..816 71..886 4080 100 Plus
l(2)05714-RC 783 CG8886-PC 209..783 312..886 2875 100 Plus
l(2)05714-RA 783 CG8886-PA 209..783 312..886 2875 100 Plus
l(2)05714-RC 783 CG8886-PC 1..210 71..280 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-RB 1082 CG8886-RB 120..1080 1..961 4805 100 Plus
l(2)05714-RC 1089 CG8886-RC 438..1087 312..961 3250 100 Plus
l(2)05714-RA 1049 CG8886-RA 398..1047 312..961 3250 100 Plus
l(2)05714-RC 1089 CG8886-RC 204..439 45..280 1180 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-PB 271 CG8886-PB 1..271 71..883 1133 100 Plus
l(2)05714-PC 260 CG8886-PC 1..260 71..883 1053 95.9 Plus
l(2)05714-PA 260 CG8886-PA 1..260 71..883 1053 95.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4970133..4970786 965..312 3255 99.8 Minus
2L 23513712 2L 4971054..4971366 313..1 1565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4970133..4970786 965..312 3255 99.8 Minus
2L 23513712 2L 4971054..4971366 313..1 1565 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:31:01 has no hits.

RE72348.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:52:36 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4970154..4970466 1..313 100   Minus
chr2L 4969235..4969884 314..963 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2010-12-06 14:16:05 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 1..816 71..886 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:33:06 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 1..816 71..886 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:52:36 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 1..816 71..886 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2010-12-06 14:16:03 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 88..1050 1..963 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:33:06 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 88..1050 1..963 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:52:36 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05714-RB 120..1082 1..963 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:52:36 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4971054..4971366 1..313 100   Minus
2L 4970135..4970784 314..963 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:33:06 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4971054..4971366 1..313 100   Minus
arm_2L 4970135..4970784 314..963 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:51:57 Download gff for RE72348.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4971054..4971366 1..313 100   Minus
2L 4970135..4970784 314..963 99 <- Minus

RE72348.hyp Sequence

Translation from 0 to 885

> RE72348.hyp
LLALIFQRILFHKSDKLHPKAGTMLKGYKTDEDKKVKRLYHQRYRTEWEK
YPELSSWLASSNDGYSAHCKICDINVLARLASIKQHLATRKHQESFKYHN
ILAKNMIKGELVKDEHDPDLEASIISPKAKPKAKSKTYPRQKPRSKMQPK
IKNDTKVESMEEETEEDEIASNDSILDDLLRTDQPYQEQEFEVENEFLEV
QQNETDLQDQEVVYEEEMIQLKPEDTEINNEYQVDAMTEDTIISEFDLFG
KSLALQLNNMDLEDALMCQERLQVVLTEFRLKVLKRKREQARSS*

RE72348.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-PB 271 CG8886-PB 1..271 24..294 1394 100 Plus
l(2)05714-PC 260 CG8886-PC 1..260 24..294 1314 95.9 Plus
l(2)05714-PA 260 CG8886-PA 1..260 24..294 1314 95.9 Plus

RE72348.pep Sequence

Translation from 1 to 885

> RE72348.pep
LLALIFQRILFHKSDKLHPKAGTMLKGYKTDEDKKVKRLYHQRYRTEWEK
YPELSSWLASSNDGYSAHCKICDINVLARLASIKQHLATRKHQESFKYHN
ILAKNMIKGELVKDEHDPDLEASIISPKAKPKAKSKTYPRQKPRSKMQPK
IKNDTKVESMEEETEEDEIASNDSILDDLLRTDQPYQEQEFEVENEFLEV
QQNETDLQDQEVVYEEEMIQLKPEDTEINNEYQVDAMTEDTIISEFDLFG
KSLALQLNNMDLEDALMCQERLQVVLTEFRLKVLKRKREQARSS*

RE72348.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23624-PA 255 GF23624-PA 14..254 33..293 588 50.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24333-PA 269 GG24333-PA 1..269 24..294 1085 85.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10242-PA 219 GH10242-PA 3..214 35..287 484 45.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)05714-PB 271 CG8886-PB 1..271 24..294 1394 100 Plus
l(2)05714-PC 260 CG8886-PC 1..260 24..294 1314 95.9 Plus
l(2)05714-PA 260 CG8886-PA 1..260 24..294 1314 95.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15353-PA 231 GI15353-PA 3..226 35..287 530 47.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20681-PA 252 GL20681-PA 1..252 25..294 515 48.1 Plus
Dper\GL20529-PA 89 GL20529-PA 1..84 25..103 261 60.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21390-PA 252 GA21390-PA 1..252 25..294 519 48.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18053-PA 272 GM18053-PA 1..272 24..294 1160 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22673-PA 275 GD22673-PA 1..275 24..294 1188 90.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:58:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17273-PA 227 GJ17273-PA 3..222 35..287 510 47 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24477-PA 365 GK24477-PA 128..361 43..289 356 35.8 Plus
Dwil\GK24477-PA 365 GK24477-PA 9..81 30..102 245 57.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18712-PA 272 GE18712-PA 1..272 24..294 1075 82.8 Plus