Clone RE72719 Report

Search the DGRC for RE72719

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:727
Well:19
Vector:pFlc-1
Associated Gene/Transcriptl(3)neo38-RA
Protein status:RE72719.pep: gold
Preliminary Size:1017
Sequenced Size:1537

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6930 2001-12-13 Blastp of sequenced clone
CG6930 2002-01-01 Sim4 clustering to Release 2
CG6930 2003-01-01 Sim4 clustering to Release 3
l(3)neo38 2008-04-29 Release 5.5 accounting
l(3)neo38 2008-08-15 Release 5.9 accounting
l(3)neo38 2008-12-18 5.12 accounting

Clone Sequence Records

RE72719.complete Sequence

1537 bp (1537 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070621

> RE72719.complete
GTCGCTTGTAGTTAGTCGGCCAGAGTGCGTTGTGCGAGAGCGGCGGCCGA
ATTGAGTTGGAAGCGGATTTGAATCCCTGTGAAAAACCCTCTTCTAATCC
TTAGACTTATAAACGATATACATAACTCACACAAAAAGGCTGTCTCACGA
TGTTTTCGGCTGCCAACAACATGCAATATGGCCAGAATATCTCCATACCG
TACTCACAGCCGCAGGGTGATCTAAACTTTCTCAATGCAGCCGCTGCGGC
CGATCATAAGGGTAAAATCCATCCAAAAATCGAACGTGACCGGGAAGAAG
TCCTCAACCAGCAGATCCTGCAGAATGTCAACCAATCCTGGCAGACGTTG
GCAAATACGGCCAACACGGTGGACTACTCGTCACACCTGCTCTCCGCCAC
ACTGCCCATCTCCATACAGCACTTCCTCAAGTACTCGGAGACGATCAAGA
AGGAGTCCACCGGCGATGTCCTGAAGAACGGCACAAATTTGGCCAGCCTG
GCGCTGGGGGGCGTGGCCCTAACGCCCAGCAACAACGGTGCGAATGGCGG
CCACCACAACGGACTGGTGGGCATGGACCATGGCGGTCACATGACCAACA
TGACGGACGCCAACGGAGCGGCGCTGACGAACGGAGCTAGCAACGGAGTG
AATGGCAATGCTAACGGCACTGTGACCAATGGTGGCGCCGGCGCCGTCTC
GAGCTCCGGATCTGTGGGCACAACAAACGCCAGCGGCGGCACAGGCACGG
CCAGCGGCAAGAAGACCAAAAAGAAGAAACCACCAAAGGAGAAGAAGCCG
CGCCCCAAACCGGGAGAAATCCGCGAGACAAAGGCGCTGGATGGCTCGAC
GCTCTACTGCTGCCCGGAGTGCCAAATGGCCTACCCGGATCGCAGCCTCA
TCGAGCAGCACGTCATCTCGCACGCCGTTGAGCGGCGCTTCGTCTGCGAC
ATCTGCAATGCGGCGCTGAAGCGCAAGGACCACCTGACCAGGCACAAGCT
CTCCCACATACCGGACAGGCCGCATGTGTGCAATATCTGCATGAAGTCCT
TCAAGCGCAAGGAGCAGCTCACTCTGCACATTGTCATCCATTCCGGCGAG
AAGAAGCATGTTTGCATTGAGTGTGGAAAAGGTTTCTATCGCAAGGATCA
CTTGCGCAAGCACACACGATCGCACATCGCCCGGCGTGTCAAGTCGGAGG
TGTCGGCGCAGAACGTTAACGGATCCGCCGGAGGCGGTGGCGGCGGTGGA
GGCGGCAACAGTGCGCAGAGCAACGCGCTGCACGGCTCCTGAGGATCGTA
CAAGGACTTCTGGTAAACTCCCAGCCGAATTTCAAGCCATAAGGGGCGGC
CAGCCTGCTGGCGGCGGTGGACAGGTGGTGTTCGTATACGGATACGACTG
ACTGCCGCCGGGAGCAGGCGAGCTGCCTTTGAAATTCGCTGGGGGCTTAC
CGGGGGTCCTGCTGAGCGTCACCCAACTCCAATTACAATAACCCTCAATA
AACACGAGTTATACTTACTGGAAAAAAAAAAAAAAAA

RE72719.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38.l 3325 l(3)neo38.l 1..1521 1..1520 7550 99.8 Plus
l(3)neo38.o 3660 l(3)neo38.o 1..1521 1..1520 7550 99.8 Plus
l(3)neo38.k 5227 l(3)neo38.k 1..1521 1..1520 7550 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7594887..7595622 1034..299 3665 99.9 Minus
chr3R 27901430 chr3R 7594129..7594519 1520..1130 1955 100 Minus
chr3R 27901430 chr3R 7596676..7596822 300..154 735 100 Minus
chr3R 27901430 chr3R 7596919..7597072 153..1 720 99.4 Minus
chr3R 27901430 chr3R 7594573..7594671 1133..1035 495 100 Minus
chr3L 24539361 chr3L 11594853..11595111 935..1193 470 78.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RL 1368 CG6930-PL 206..1368 154..1316 5800 99.9 Plus
l(3)neo38-RA 1143 CG6930-PA 1..1143 150..1292 5700 99.9 Plus
l(3)neo38-RK 1344 CG6930-PK 206..1344 154..1292 5680 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:15:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RA 1522 CG6930-RA 1..1521 1..1520 7540 99.9 Plus
l(3)neo38-RL 2247 CG6930-RL 880..2246 154..1520 6820 99.9 Plus
l(3)neo38-RK 1611 CG6930-RK 244..1610 154..1520 6820 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PL 455 CG6930-PL 70..455 156..1313 1329 99.7 Plus
l(3)neo38-PA 380 CG6930-PA 1..351 150..1202 1302 100 Plus
l(3)neo38-PK 447 CG6930-PK 70..418 156..1202 1291 100 Plus
l(3)neo38-PC 447 CG6930-PC 70..418 156..1202 1291 100 Plus
l(3)neo38-PB 447 CG6930-PB 70..418 156..1202 1291 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11769370..11770105 1034..299 3665 99.9 Minus
3R 32079331 3R 11768612..11769002 1520..1130 1955 100 Minus
3R 32079331 3R 11771154..11771300 300..154 735 100 Minus
3R 32079331 3R 11771397..11771550 153..1 720 99.4 Minus
3R 32079331 3R 11769056..11769154 1133..1035 495 100 Minus
3L 28110227 3L 11603938..11604196 935..1193 470 78.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11510201..11510936 1034..299 3665 99.8 Minus
3R 31820162 3R 11509443..11509833 1520..1130 1955 100 Minus
3R 31820162 3R 11511985..11512131 300..154 735 100 Minus
3R 31820162 3R 11512228..11512381 153..1 730 99.3 Minus
3R 31820162 3R 11509887..11509985 1133..1035 495 100 Minus
3L 28103327 3L 11597141..11597206 1038..1103 225 89.3 Plus
3L 28103327 3L 11597222..11597296 1119..1193 195 84 Plus
3L 28103327 3L 11597038..11597100 935..997 180 85.7 Plus
Blast to na_te.dros performed on 2014-11-26 20:46:48 has no hits.

RE72719.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:45:24 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7596919..7597072 1..153 99   Minus
chr3R 7596676..7596822 154..300 100 <- Minus
chr3R 7594887..7595620 301..1034 99 <- Minus
chr3R 7594575..7594671 1035..1131 100 <- Minus
chr3R 7594128..7594517 1132..1521 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:15 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1143 150..1292 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:27 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1143 150..1292 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:07:06 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RL 206..1368 154..1316 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:34 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1143 150..1292 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:24 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RL 206..1368 154..1316 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:46 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1520 1..1519 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:27 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1520 1..1519 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:07:06 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1521 1..1521 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:34 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1520 1..1519 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:24 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1521 1..1521 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:45:24 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11771397..11771550 1..153 99   Minus
3R 11771154..11771300 154..300 100 <- Minus
3R 11769370..11770103 301..1034 99 <- Minus
3R 11769058..11769154 1035..1131 100 <- Minus
3R 11768611..11769000 1132..1521 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:07:06 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7597119..7597272 1..153 99   Minus
arm_3R 7596876..7597022 154..300 100 <- Minus
arm_3R 7595092..7595825 301..1034 99 <- Minus
arm_3R 7594780..7594876 1035..1131 100 <- Minus
arm_3R 7594333..7594722 1132..1521 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:38 Download gff for RE72719.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11512228..11512381 1..153 99   Minus
3R 11511985..11512131 154..300 100 <- Minus
3R 11510201..11510934 301..1034 99 <- Minus
3R 11509889..11509985 1035..1131 100 <- Minus
3R 11509442..11509831 1132..1521 99 <- Minus

RE72719.pep Sequence

Translation from 149 to 1291

> RE72719.pep
MFSAANNMQYGQNISIPYSQPQGDLNFLNAAAAADHKGKIHPKIERDREE
VLNQQILQNVNQSWQTLANTANTVDYSSHLLSATLPISIQHFLKYSETIK
KESTGDVLKNGTNLASLALGGVALTPSNNGANGGHHNGLVGMDHGGHMTN
MTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTNASGGTGT
ASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSL
IEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKS
FKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSE
VSAQNVNGSAGGGGGGGGGNSAQSNALHGS*

RE72719.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16617-PA 451 GF16617-PA 73..451 3..380 1693 93.7 Plus
Dana\GF16931-PA 1364 GF16931-PA 1182..1312 211..346 226 36.5 Plus
Dana\GF23400-PA 940 GF23400-PA 388..498 232..342 224 41.4 Plus
Dana\GF23400-PA 940 GF23400-PA 297..414 225..342 218 37.3 Plus
Dana\GF23400-PA 940 GF23400-PA 418..526 234..342 216 39.4 Plus
Dana\GF18492-PA 929 GF18492-PA 676..835 213..362 210 36 Plus
Dana\GF23400-PA 940 GF23400-PA 360..470 232..342 209 39.6 Plus
Dana\GF19706-PA 454 GF19706-PA 148..254 236..342 209 35.5 Plus
Dana\GF23400-PA 940 GF23400-PA 478..582 238..342 208 39 Plus
Dana\GF23400-PA 940 GF23400-PA 269..386 225..342 201 34.7 Plus
Dana\GF16931-PA 1364 GF16931-PA 1226..1336 232..342 199 36 Plus
Dana\GF23400-PA 940 GF23400-PA 444..554 232..342 195 37.8 Plus
Dana\GF23400-PA 940 GF23400-PA 332..442 232..342 184 35.1 Plus
Dana\GF19706-PA 454 GF19706-PA 206..308 238..340 182 35 Plus
Dana\GF23400-PA 940 GF23400-PA 500..615 232..346 181 36.2 Plus
Dana\GF23400-PA 940 GF23400-PA 534..639 238..342 178 36.8 Plus
Dana\GF23400-PA 940 GF23400-PA 562..671 238..342 157 34.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17195-PA 446 GG17195-PA 69..446 3..380 2014 100 Plus
Dere\GG15515-PA 529 GG15515-PA 309..442 220..353 574 70.1 Plus
Dere\GG22637-PA 1243 GG22637-PA 1034..1125 261..350 222 41.3 Plus
Dere\GG13168-PA 926 GG13168-PA 291..432 181..342 221 34.6 Plus
Dere\GG10297-PA 612 GG10297-PA 36..146 232..342 218 41.4 Plus
Dere\GG13168-PA 926 GG13168-PA 520..632 235..346 203 34.5 Plus
Dere\GG13168-PA 926 GG13168-PA 547..659 233..343 157 29.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23160-PA 370 GH23160-PA 1..370 1..380 1642 92.1 Plus
Dgri\GH14859-PA 551 GH14859-PA 339..470 220..351 585 72 Plus
Dgri\GH13073-PA 979 GH13073-PA 417..527 232..342 223 41.4 Plus
Dgri\GH15079-PA 1205 GH15079-PA 1040..1131 261..350 222 41.3 Plus
Dgri\GH13073-PA 979 GH13073-PA 337..443 236..342 217 39.3 Plus
Dgri\GH13073-PA 979 GH13073-PA 447..555 234..342 215 39.4 Plus
Dgri\GH17759-PA 564 GH17759-PA 400..510 232..342 214 40.5 Plus
Dgri\GH13073-PA 979 GH13073-PA 389..499 232..342 208 39.6 Plus
Dgri\GH13073-PA 979 GH13073-PA 507..611 238..342 208 39 Plus
Dgri\GH13073-PA 979 GH13073-PA 298..415 225..342 200 34.7 Plus
Dgri\GH13073-PA 979 GH13073-PA 473..583 232..342 194 37.8 Plus
Dgri\GH13073-PA 979 GH13073-PA 361..471 232..342 183 35.1 Plus
Dgri\GH13073-PA 979 GH13073-PA 535..644 238..346 180 37.3 Plus
Dgri\GH13073-PA 979 GH13073-PA 563..668 238..342 177 36.8 Plus
Dgri\GH13073-PA 979 GH13073-PA 591..700 238..342 154 34.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PA 380 CG6930-PA 1..380 1..380 2013 100 Plus
l(3)neo38-PK 447 CG6930-PK 70..447 3..380 2002 100 Plus
l(3)neo38-PC 447 CG6930-PC 70..447 3..380 2002 100 Plus
l(3)neo38-PB 447 CG6930-PB 70..447 3..380 2002 100 Plus
l(3)neo38-PL 455 CG6930-PL 70..447 3..380 2002 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:58:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10303-PA 438 GI10303-PA 64..413 3..353 1589 91.5 Plus
Dmoj\GI13709-PA 559 GI13709-PA 332..465 220..353 576 70.9 Plus
Dmoj\GI23713-PA 1171 GI23713-PA 1011..1102 261..350 223 41.3 Plus
Dmoj\GI17692-PA 965 GI17692-PA 401..511 232..342 221 41.4 Plus
Dmoj\GI11869-PA 996 GI11869-PA 330..455 221..346 221 35.7 Plus
Dmoj\GI17692-PA 965 GI17692-PA 321..427 236..342 215 39.3 Plus
Dmoj\GI17692-PA 965 GI17692-PA 431..539 234..342 214 39.4 Plus
Dmoj\GI17692-PA 965 GI17692-PA 373..483 232..342 206 39.6 Plus
Dmoj\GI17692-PA 965 GI17692-PA 491..595 238..342 206 39 Plus
Dmoj\GI17692-PA 965 GI17692-PA 282..399 225..342 199 34.7 Plus
Dmoj\GI17692-PA 965 GI17692-PA 457..567 232..342 193 37.8 Plus
Dmoj\GI17692-PA 965 GI17692-PA 345..455 232..342 181 35.1 Plus
Dmoj\GI17692-PA 965 GI17692-PA 519..628 238..346 179 37.3 Plus
Dmoj\GI17692-PA 965 GI17692-PA 547..652 238..342 175 36.8 Plus
Dmoj\GI17692-PA 965 GI17692-PA 575..684 238..342 153 34.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12249-PA 438 GL12249-PA 67..438 3..380 1602 93.9 Plus
Dper\GL22806-PA 457 GL22806-PA 242..375 220..353 565 69.4 Plus
Dper\GL18890-PA 932 GL18890-PA 379..489 232..342 221 41.4 Plus
Dper\GL18890-PA 932 GL18890-PA 288..405 225..342 215 37.3 Plus
Dper\GL18890-PA 932 GL18890-PA 409..517 234..342 214 39.4 Plus
Dper\GL20485-PA 318 GL20485-PA 123..233 236..346 213 36.9 Plus
Dper\GL18890-PA 932 GL18890-PA 351..461 232..342 207 39.6 Plus
Dper\GL18890-PA 932 GL18890-PA 469..573 238..342 206 39 Plus
Dper\GL20484-PA 235 GL20484-PA 62..176 232..346 206 35.7 Plus
Dper\GL20485-PA 318 GL20485-PA 175..286 232..343 199 37.5 Plus
Dper\GL18890-PA 932 GL18890-PA 260..377 225..342 198 34.7 Plus
Dper\GL18890-PA 932 GL18890-PA 435..545 232..342 193 37.8 Plus
Dper\GL20485-PA 318 GL20485-PA 119..201 260..342 183 41 Plus
Dper\GL18890-PA 932 GL18890-PA 323..433 232..342 181 35.1 Plus
Dper\GL18890-PA 932 GL18890-PA 497..606 238..346 179 37.3 Plus
Dper\GL18890-PA 932 GL18890-PA 525..630 238..342 175 36.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19962-PA 438 GA19962-PA 67..438 3..380 1650 95.8 Plus
Dpse\GA20302-PA 529 GA20302-PA 314..447 220..353 575 69.4 Plus
Dpse\GA27565-PA 1219 GA27565-PA 1063..1154 261..350 226 41.3 Plus
Dpse\GA25849-PB 870 GA25849-PB 297..407 232..342 222 41.4 Plus
Dpse\GA25849-PB 870 GA25849-PB 409..519 232..342 217 40.5 Plus
Dpse\GA25849-PB 870 GA25849-PB 206..323 225..342 216 37.3 Plus
Dpse\GA17791-PA 703 GA17791-PA 271..399 219..346 213 32.6 Plus
Dpse\GA25849-PB 870 GA25849-PB 327..435 234..342 208 38.5 Plus
Dpse\GA25849-PB 870 GA25849-PB 387..491 238..342 208 39 Plus
Dpse\GA25849-PB 870 GA25849-PB 269..379 232..342 207 39.6 Plus
Dpse\GA25849-PB 870 GA25849-PB 353..463 232..342 182 35.1 Plus
Dpse\GA25849-PB 870 GA25849-PB 241..351 232..342 182 35.1 Plus
Dpse\GA25849-PB 870 GA25849-PB 437..552 232..346 180 36.2 Plus
Dpse\GA25849-PB 870 GA25849-PB 471..576 238..342 176 36.8 Plus
Dpse\GA25849-PB 870 GA25849-PB 499..608 238..342 151 34.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26073-PA 380 GM26073-PA 1..380 1..380 2025 100 Plus
Dsec\GM10968-PA 929 GM10968-PA 385..495 232..342 222 41.4 Plus
Dsec\GM22079-PA 964 GM22079-PA 313..438 221..346 220 35.7 Plus
Dsec\GM10968-PA 929 GM10968-PA 294..411 225..342 216 37.3 Plus
Dsec\GM15276-PA 1236 GM15276-PA 1014..1103 261..348 216 40 Plus
Dsec\GM10968-PA 929 GM10968-PA 415..523 234..342 215 39.4 Plus
Dsec\GM11438-PA 887 GM11438-PA 588..710 224..346 212 33.3 Plus
Dsec\GM10968-PA 929 GM10968-PA 357..467 232..342 207 39.6 Plus
Dsec\GM10968-PA 929 GM10968-PA 475..579 238..342 207 39 Plus
Dsec\GM22079-PA 964 GM22079-PA 495..669 162..346 202 29.2 Plus
Dsec\GM10968-PA 929 GM10968-PA 266..383 225..342 200 34.7 Plus
Dsec\GM10968-PA 929 GM10968-PA 441..551 232..342 194 37.8 Plus
Dsec\GM10968-PA 929 GM10968-PA 329..439 232..342 182 35.1 Plus
Dsec\GM10968-PA 929 GM10968-PA 503..612 238..346 179 37.3 Plus
Dsec\GM10968-PA 929 GM10968-PA 531..636 238..342 176 36.8 Plus
Dsec\GM22079-PA 964 GM22079-PA 584..696 233..343 155 29.2 Plus
Dsec\GM10968-PA 929 GM10968-PA 559..668 238..342 154 34.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20637-PA 447 GD20637-PA 69..447 2..380 2013 99.7 Plus
Dsim\GD19200-PA 1019 GD19200-PA 865..956 261..350 223 41.3 Plus
Dsim\GD22157-PA 782 GD22157-PA 233..343 232..342 222 41.4 Plus
Dsim\GD22157-PA 782 GD22157-PA 263..371 234..342 215 39.4 Plus
Dsim\GD21213-PA 1344 GD21213-PA 1168..1297 210..346 213 34.3 Plus
Dsim\GD23545-PA 558 GD23545-PA 220..344 221..342 211 37.6 Plus
Dsim\GD22157-PA 782 GD22157-PA 317..427 232..342 207 37.8 Plus
Dsim\GD21213-PA 1344 GD21213-PA 1211..1317 232..338 198 36.4 Plus
Dsim\GD22157-PA 782 GD22157-PA 289..399 232..342 194 37.8 Plus
Dsim\GD22157-PA 782 GD22157-PA 345..460 232..346 180 36.2 Plus
Dsim\GD22157-PA 782 GD22157-PA 379..484 238..342 176 36.8 Plus
Dsim\GD22157-PA 782 GD22157-PA 407..516 238..342 153 34.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10157-PA 434 GJ10157-PA 65..434 3..380 1554 88.2 Plus
Dvir\GJ14051-PA 545 GJ14051-PA 328..461 220..353 577 70.9 Plus
Dvir\GJ23272-PA 1185 GJ23272-PA 1017..1108 261..350 224 41.3 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 406..516 232..342 222 41.4 Plus
Dvir\GJ18900-PA 571 GJ18900-PA 403..513 232..342 218 40.5 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 326..432 236..342 216 39.3 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 436..544 234..342 215 39.4 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 378..488 232..342 207 39.6 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 496..600 238..342 207 39 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 287..404 225..342 200 34.7 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 462..572 232..342 194 37.8 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 350..460 232..342 182 35.1 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 524..633 238..346 180 37.3 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 552..657 238..342 176 36.8 Plus
Dvir\GJ17478-PA 961 GJ17478-PA 580..689 238..342 154 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11983-PA 447 GK11983-PA 68..447 3..380 1549 87.4 Plus
Dwil\GK17174-PA 563 GK17174-PA 341..474 220..353 581 70.1 Plus
Dwil\GK20499-PA 919 GK20499-PA 223..422 120..342 234 29.6 Plus
Dwil\GK11242-PA 923 GK11242-PA 765..859 261..353 220 41.1 Plus
Dwil\GK14973-PA 1011 GK14973-PA 394..504 232..342 220 40.5 Plus
Dwil\GK20499-PA 919 GK20499-PA 514..622 238..346 201 33.9 Plus
Dwil\GK20499-PA 919 GK20499-PA 537..649 233..343 155 29.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10087-PA 446 GE10087-PA 69..446 3..380 2007 99.5 Plus
Dyak\GE12687-PA 782 GE12687-PA 233..343 232..342 222 41.4 Plus
Dyak\GE13170-PA 481 GE13170-PA 345..451 236..342 219 42.1 Plus
Dyak\GE19490-PA 815 GE19490-PA 307..428 221..342 219 36.1 Plus
Dyak\GE12687-PA 782 GE12687-PA 263..371 234..342 215 39.4 Plus
Dyak\GE17353-PA 1584 GE17353-PA 1328..1440 238..347 213 40.5 Plus
Dyak\GE12687-PA 782 GE12687-PA 317..427 232..342 207 37.8 Plus
Dyak\GE19490-PA 815 GE19490-PA 454..628 162..346 203 29.2 Plus
Dyak\GE12687-PA 782 GE12687-PA 289..399 232..342 194 37.8 Plus
Dyak\GE12687-PA 782 GE12687-PA 345..460 232..346 180 36.2 Plus
Dyak\GE12687-PA 782 GE12687-PA 379..484 238..342 176 36.8 Plus
Dyak\GE13170-PA 481 GE13170-PA 319..423 238..342 174 37.1 Plus
Dyak\GE19490-PA 815 GE19490-PA 543..655 233..343 157 29.2 Plus
Dyak\GE12687-PA 782 GE12687-PA 407..516 238..342 153 34.5 Plus

RE72719.hyp Sequence

Translation from 149 to 1291

> RE72719.hyp
MFSAANNMQYGQNISIPYSQPQGDLNFLNAAAAADHKGKIHPKIERDREE
VLNQQILQNVNQSWQTLANTANTVDYSSHLLSATLPISIQHFLKYSETIK
KESTGDVLKNGTNLASLALGGVALTPSNNGANGGHHNGLVGMDHGGHMTN
MTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTNASGGTGT
ASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSL
IEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKS
FKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSE
VSAQNVNGSAGGGGGGGGGNSAQSNALHGS*

RE72719.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PA 380 CG6930-PA 1..380 1..380 2013 100 Plus
l(3)neo38-PK 447 CG6930-PK 70..447 3..380 2002 100 Plus
l(3)neo38-PC 447 CG6930-PC 70..447 3..380 2002 100 Plus
l(3)neo38-PB 447 CG6930-PB 70..447 3..380 2002 100 Plus
l(3)neo38-PL 455 CG6930-PL 70..447 3..380 2002 100 Plus