Clone RE72980 Report

Search the DGRC for RE72980

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:729
Well:80
Vector:pFlc-1
Associated Gene/TranscriptMal-A1-RA
Protein status:RE72980.pep: gold
Preliminary Size:1799
Sequenced Size:1838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8696 2001-12-13 Blastp of sequenced clone
CG8696 2002-01-01 Sim4 clustering to Release 2
CG8696 2003-01-01 Sim4 clustering to Release 3
LvpH 2008-04-29 Release 5.5 accounting
LvpH 2008-08-15 Release 5.9 accounting
LvpH 2008-12-18 5.12 accounting

Clone Sequence Records

RE72980.complete Sequence

1838 bp (1838 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070626

> RE72980.complete
GGCAAAATCGATCAAAATGCGCCCGCAATCAGCTGCGTGTCTATTACTGG
CCATCGTTGGCTTCGTGGGAGCCACCGAGTGGTGGGAGAGTGGAAACTAC
TACCAGATCTACCCGCGCTCCTTCCGGGATTCCGACGGAGACGGCATTGG
CGACCTGAACGGGGTCACTGAAAAGCTGCAGTACCTGAAAGACATCGGCT
TCACGGGCACATGGCTGTCGCCCATATTCAAGTCGCCCATGGTCGACTTT
GGTTACGACATATCGGACTTCTACCAGATCCATCCCGAATATGGAACCAT
GGAGGACTTTGAGCGAATGATCGCCAAGGCCAAGGAGGTGGGCATTAAAA
TCATCCTGGACTTCGTACCAAACCACTCAAGTACCGAAAACGAATGGTTC
ACCAAGTCTGTGGACAGTGACCCCGTCTACAAAGACTTCTACATCTGGCA
CGATGGCAAGATCAACAACGAGACCGGTGAGCGGGAGCCGCCGAGCAACT
GGAACTCTGAGTTTCGCTACAGCGCCTGGGAGTGGAACGAGGTGCGTCAG
CAGTACTACCTCCACCAGTTCGCCATCCAGCAGGCCGACCTCAACTATCG
CAATCCGGCCGTGGTTAACGAGATGAAGAACGTTATTCGCTTCTGGCTGG
GAAAGGGAGTATCCGGATTCCGTATAGATGCAGTTCCCTACTTGTTTGAG
GTGGATCTCGATCGCTACAACCAGTATCCGGACGAGCCTCTGACCAACGA
CTCCGTGAACTGTCCCGACCCCGATGACCACTGCTACACGCAGCACATCT
ATACACAGGACATGCCGGAAACAATTGACATGGTGTACCAGTGGCGTGAG
TTGGTGGATGAGTTTCATGTGGAGAACGGCGGAGATAAGAGGCTGCTGAT
GACGGAGGCGTACACCAGCTTTGAAAACATCATGACTTACTATGGAAATG
GAGTCAGGAATGGCTCCCACATTCCCTTCAACTTTGACTTCCTTACGAGC
ATCAACAACGCCTCTAAGGCCGGAGAGTACGTAGAACATATTAAGAAGTG
GATGGACGCCATGCCCGAGGGCGTTTATGCCAATTGGGTGCTGGGCAACC
ACGACAACAAGCGAGTAGCCTCCCGATTTGGTGTCCAGCGCACCGACCTT
ATCAACATCCTGCTGCAGACTCTGCCCGGCCACGCGGTCACCTACAATGG
AGAGGAGCTGGGCATGACCGACGTCTGGATCAGCTGGGAGGACACCGTTG
ATCCGAATGCGTGCAACTCCGATCCCGACAACTACTACGCCCGATCCAGG
GATCCTGCCCGATCTCCCTACCAGTGGGATGCCTCCTCCAAAGCAGGCTT
CACCAGTGCCGATCACACCTGGTTACCAGTGGCTGATGACTACAAAACCA
ACAACGCCCTGCAGCAGCTGCGAGCTCCACGTTCCCACCTGCAGATCTTC
AAGAAACTGGTGCGCGTGCGCAAGGAGCCATCTTTTCGCCAGGGAGAACT
CAACATTCAGGCAATCGACGACGATGTGATCATCTATTCACGACAAAAGA
CCGGAAGCGATCTCTATGTAATCGTTCTCAACCTGGGTAGCACCTCCAAG
ACCTTGGACCTGACCAAGTATTACGAACTGGGCACCCAGGCGGAGGTCAT
TACCACGTCCTTGAGCTCCCAGTACATCGATGGCGATGTTATCAAATCTA
CGGAGTTCGTTGCCAATCCCTATGTGGGCACCGTCCTAGTGGCTGTCTAA
GCTAATTTTATTCAAATAAGTGACAATAAAGTAGCGCTGATAAATAAAAT
GTGAATTATACATGTACTTATCAAAAAAAAAAAAAAAA

RE72980.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
LvpH-RA 1993 LvpH-RA 108..1930 3..1825 9115 100 Plus
CG11669-RA 2736 CG11669-RA 1207..1286 527..606 190 82.5 Plus
CG11669-RA 2736 CG11669-RA 35..87 264..212 190 90.5 Minus
CG11669.a 2932 CG11669.a 1207..1286 527..606 190 82.5 Plus
CG11669.a 2932 CG11669.a 35..87 264..212 190 90.5 Minus
CG11669-RA 2736 CG11669-RA 892..950 212..270 175 86.4 Plus
CG11669.a 2932 CG11669.a 892..950 212..270 175 86.4 Plus
CG11669-RA 2736 CG11669-RA 137..199 162..100 150 82.5 Minus
CG11669.a 2932 CG11669.a 137..199 162..100 150 82.5 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4338082..4339426 1347..3 6725 100 Minus
chr2R 21145070 chr2R 4337192..4337472 1822..1542 1405 100 Minus
chr2R 21145070 chr2R 4337530..4337732 1546..1344 1000 99.5 Minus
chr2R 21145070 chr2R 4359627..4360133 100..606 495 73.2 Plus
chr2R 21145070 chr2R 4352848..4353372 104..628 420 72 Plus
chr2R 21145070 chr2R 4346441..4346723 100..382 230 72.1 Plus
chr2R 21145070 chr2R 4358876..4359042 270..104 220 75.4 Minus
chr2R 21145070 chr2R 4344103..4344161 1248..1190 205 89.8 Minus
chr2R 21145070 chr2R 4358540..4358619 606..527 190 82.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-RA 1734 CG8696-PA 1..1734 17..1750 8670 100 Plus
Mal-A8-RA 1767 CG8690-PA 117..623 100..606 495 73.2 Plus
Mal-A6-RC 1806 CG30360-PC 151..675 104..628 420 72 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:15:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-RA 1826 CG8696-RA 7..1826 3..1822 9100 100 Plus
Mal-A8-RA 1814 CG8690-RA 146..652 100..606 495 73.2 Plus
Mal-A6-RC 1892 CG30360-RC 163..687 104..628 420 72 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-PA 577 CG8696-PA 1..577 17..1747 3123 100 Plus
Mal-A5-PA 630 CG30359-PA 43..593 77..1738 1592 52.5 Plus
Mal-A3-PA 574 CG8695-PA 8..574 35..1747 1567 50 Plus
Mal-A4-PA 579 CG8693-PA 13..573 47..1738 1562 50.1 Plus
Mal-A8-PA 588 CG8690-PA 32..567 77..1684 1562 53.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8450554..8451898 1347..3 6725 100 Minus
2R 25286936 2R 8449661..8449944 1825..1542 1420 100 Minus
2R 25286936 2R 8450002..8450204 1546..1344 1000 99.5 Minus
2R 25286936 2R 8472099..8472605 100..606 495 73.2 Plus
2R 25286936 2R 8465320..8465844 104..628 420 72 Plus
2R 25286936 2R 8458913..8459195 100..382 230 72.1 Plus
2R 25286936 2R 8471348..8471514 270..104 220 75.4 Minus
2R 25286936 2R 8456575..8456633 1248..1190 205 89.8 Minus
2R 25286936 2R 8471012..8471091 606..527 190 82.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8451753..8453097 1347..3 6725 100 Minus
2R 25260384 2R 8450860..8451143 1825..1542 1420 100 Minus
2R 25260384 2R 8451201..8451403 1546..1344 1000 99.5 Minus
2R 25260384 2R 8466519..8466815 104..400 315 73.7 Plus
2R 25260384 2R 8473722..8473804 524..606 280 89.1 Plus
2R 25260384 2R 8466936..8467043 521..628 255 82.4 Plus
2R 25260384 2R 8457774..8457832 1248..1190 205 89.8 Minus
2R 25260384 2R 8473410..8473462 212..264 190 90.5 Plus
2R 25260384 2R 8472211..8472290 606..527 190 82.5 Minus
2R 25260384 2R 8472547..8472605 270..212 175 86.4 Minus
2R 25260384 2R 8473298..8473360 100..162 150 82.5 Plus
Blast to na_te.dros performed on 2014-11-27 08:46:33 has no hits.

RE72980.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:10:39 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4338083..4339426 1..1346 99   Minus
chr2R 4337534..4337729 1347..1542 100 <- Minus
chr2R 4337192..4337471 1543..1822 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:36:24 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
LvpH-RA 1..1734 17..1750 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:04 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
LvpH-RA 1..1734 17..1750 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:22 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A1-RA 1..1734 17..1750 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:42:09 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
LvpH-RA 1..1734 17..1750 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:10:39 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A1-RA 1..1734 17..1750 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:48:06 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
LvpH-RA 2..1821 3..1822 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:04 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
LvpH-RA 2..1821 3..1822 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:22 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A1-RA 4..1826 1..1822 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:42:10 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
LvpH-RA 2..1821 3..1822 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:10:39 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
Mal-A1-RA 4..1826 1..1822 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:10:39 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8450555..8451898 1..1346 99   Minus
2R 8450006..8450201 1347..1542 100 <- Minus
2R 8449664..8449943 1543..1822 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:22 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4338060..4339403 1..1346 99   Minus
arm_2R 4337511..4337706 1347..1542 100 <- Minus
arm_2R 4337169..4337448 1543..1822 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:18:12 Download gff for RE72980.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8451754..8453097 1..1346 99   Minus
2R 8451205..8451400 1347..1542 100 <- Minus
2R 8450863..8451142 1543..1822 100 <- Minus

RE72980.hyp Sequence

Translation from 4 to 1749

> RE72980.hyp
KSIKMRPQSAACLLLAIVGFVGATEWWESGNYYQIYPRSFRDSDGDGIGD
LNGVTEKLQYLKDIGFTGTWLSPIFKSPMVDFGYDISDFYQIHPEYGTME
DFERMIAKAKEVGIKIILDFVPNHSSTENEWFTKSVDSDPVYKDFYIWHD
GKINNETGEREPPSNWNSEFRYSAWEWNEVRQQYYLHQFAIQQADLNYRN
PAVVNEMKNVIRFWLGKGVSGFRIDAVPYLFEVDLDRYNQYPDEPLTNDS
VNCPDPDDHCYTQHIYTQDMPETIDMVYQWRELVDEFHVENGGDKRLLMT
EAYTSFENIMTYYGNGVRNGSHIPFNFDFLTSINNASKAGEYVEHIKKWM
DAMPEGVYANWVLGNHDNKRVASRFGVQRTDLINILLQTLPGHAVTYNGE
ELGMTDVWISWEDTVDPNACNSDPDNYYARSRDPARSPYQWDASSKAGFT
SADHTWLPVADDYKTNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELN
IQAIDDDVIIYSRQKTGSDLYVIVLNLGSTSKTLDLTKYYELGTQAEVIT
TSLSSQYIDGDVIKSTEFVANPYVGTVLVAV*

RE72980.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-PA 577 CG8696-PA 1..577 5..581 3123 100 Plus
Mal-A5-PA 630 CG30359-PA 43..593 25..578 1592 52.5 Plus
Mal-A3-PA 574 CG8695-PA 8..574 11..581 1567 50 Plus
Mal-A4-PA 579 CG8693-PA 13..573 15..578 1562 50.1 Plus
Mal-A8-PA 588 CG8690-PA 32..567 25..560 1562 53.1 Plus

RE72980.pep Sequence

Translation from 16 to 1749

> RE72980.pep
MRPQSAACLLLAIVGFVGATEWWESGNYYQIYPRSFRDSDGDGIGDLNGV
TEKLQYLKDIGFTGTWLSPIFKSPMVDFGYDISDFYQIHPEYGTMEDFER
MIAKAKEVGIKIILDFVPNHSSTENEWFTKSVDSDPVYKDFYIWHDGKIN
NETGEREPPSNWNSEFRYSAWEWNEVRQQYYLHQFAIQQADLNYRNPAVV
NEMKNVIRFWLGKGVSGFRIDAVPYLFEVDLDRYNQYPDEPLTNDSVNCP
DPDDHCYTQHIYTQDMPETIDMVYQWRELVDEFHVENGGDKRLLMTEAYT
SFENIMTYYGNGVRNGSHIPFNFDFLTSINNASKAGEYVEHIKKWMDAMP
EGVYANWVLGNHDNKRVASRFGVQRTDLINILLQTLPGHAVTYNGEELGM
TDVWISWEDTVDPNACNSDPDNYYARSRDPARSPYQWDASSKAGFTSADH
TWLPVADDYKTNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAI
DDDVIIYSRQKTGSDLYVIVLNLGSTSKTLDLTKYYELGTQAEVITTSLS
SQYIDGDVIKSTEFVANPYVGTVLVAV*

RE72980.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 19:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Mal-A1-PA 577 GF12587-PA 1..577 1..577 2854 90.6 Plus
Dana\Mal-A5-PA 630 GF12362-PA 43..593 21..574 1575 52.9 Plus
Dana\Mal-A8-PA 588 GF12364-PA 32..567 21..556 1563 53.6 Plus
Dana\Mal-A3-PA 574 GF12586-PA 23..574 22..577 1556 51.7 Plus
Dana\Mal-A4-PA 579 GF12361-PA 13..573 11..574 1539 49.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 19:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Mal-A1-PA 577 GG10641-PA 1..577 1..577 3031 96.9 Plus
Dere\Mal-A5-PA 630 GG23362-PA 35..593 14..574 1578 52.5 Plus
Dere\Mal-A4-PA 579 GG23360-PA 20..573 18..574 1549 51.5 Plus
Dere\Mal-A3-PA 574 GG10640-PA 23..574 22..577 1548 51 Plus
Dere\Mal-A7-PA 599 GG10639-PA 37..578 21..562 1534 51.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 19:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20813-PA 576 GH20813-PA 1..576 1..577 2613 80.9 Plus
Dgri\GH21094-PA 594 GH21094-PA 33..594 18..577 1575 51.1 Plus
Dgri\GH21093-PA 634 GH21093-PA 43..584 21..568 1546 52.4 Plus
Dgri\GH20809-PA 589 GH20809-PA 33..573 21..561 1545 53 Plus
Dgri\GH21092-PA 578 GH21092-PA 6..572 7..574 1531 50 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 19:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
Mal-A1-PA 577 CG8696-PA 1..577 1..577 3123 100 Plus
Mal-A5-PA 630 CG30359-PA 43..593 21..574 1592 52.5 Plus
Mal-A3-PA 574 CG8695-PA 8..574 7..577 1567 50 Plus
Mal-A4-PA 579 CG8693-PA 13..573 11..574 1562 50.1 Plus
Mal-A8-PA 588 CG8690-PA 32..567 21..556 1562 53.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 19:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Mal-A1-PA 577 GI20901-PA 1..576 1..577 2603 81.6 Plus
Dmoj\Mal-A3-PA 574 GI20898-PA 23..574 22..577 1616 53.3 Plus
Dmoj\Mal-A7-PA 588 GI20897-PA 1..572 1..561 1579 51.7 Plus
Dmoj\Mal-A5-PA 626 GI18697-PA 40..592 19..577 1578 52 Plus
Dmoj\Mal-A4-PA 578 GI18696-PA 8..572 6..574 1543 50.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 19:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10861-PA 579 GL10861-PA 1..578 1..577 2664 84.1 Plus
Dper\GL11225-PA 630 GL11225-PA 43..593 21..574 1603 53.1 Plus
Dper\GL11227-PA 598 GL11227-PA 26..597 4..576 1588 52.1 Plus
Dper\GL11226-PA 605 GL11226-PA 46..605 21..577 1547 50.3 Plus
Dper\GL11224-PA 579 GL11224-PA 20..573 18..574 1540 51.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 19:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Mal-A1-PA 579 GA24513-PA 20..578 19..577 2742 88.7 Plus
Dpse\Mal-A5-PA 630 GA24651-PA 43..593 21..574 1611 53.1 Plus
Dpse\Mal-A8-PA 598 GA21261-PA 26..597 4..576 1587 52.1 Plus
Dpse\Mal-A6-PA 605 GA15787-PA 46..605 21..577 1543 50.1 Plus
Dpse\Mal-A4-PA 579 GA24650-PA 20..573 18..574 1539 51.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 19:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Mal-A1-PA 577 GM20686-PA 1..577 1..577 3069 98.4 Plus
Dsec\Mal-A5-PA 630 GM21036-PA 40..593 18..574 1585 52.4 Plus
Dsec\Mal-A3-PA 574 GM20685-PA 23..574 22..577 1551 51 Plus
Dsec\Mal-A7-PA 599 GM20684-PA 37..578 21..562 1534 52.1 Plus
Dsec\Mal-A4-PA 579 GM21035-PA 20..573 18..574 1526 50.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 19:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Mal-A1-PA 577 GD10169-PA 1..577 1..577 3061 98.4 Plus
Dsim\GD10567-PA 630 GD10567-PA 40..593 18..574 1589 52.4 Plus
Dsim\Mal-A8-PA 588 GD10570-PA 32..587 21..576 1563 52.2 Plus
Dsim\Mal-A6-PA 601 GD10569-PA 42..601 21..577 1524 50.3 Plus
Dsim\GD10167-PA 535 GD10167-PA 16..527 33..548 1467 51.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 19:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Mal-A1-PA 577 GJ20632-PA 1..576 1..577 2634 81.5 Plus
Dvir\Mal-A5-PA 636 GJ21715-PA 43..590 21..574 1579 52.5 Plus
Dvir\Mal-A3-PA 575 GJ20630-PA 7..575 5..577 1570 50.5 Plus
Dvir\Mal-A7-PA 588 GJ20629-PA 30..571 19..560 1560 53 Plus
Dvir\Mal-A4-PA 578 GJ21713-PA 20..572 18..574 1555 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 19:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21812-PA 579 GK21812-PA 1..578 1..577 2699 84.4 Plus
Dwil\GK21505-PA 632 GK21505-PA 38..590 19..574 1607 52.5 Plus
Dwil\GK21811-PA 578 GK21811-PA 9..578 5..577 1554 49.9 Plus
Dwil\GK21810-PA 589 GK21810-PA 4..574 2..562 1544 50.5 Plus
Dwil\GK21504-PA 579 GK21504-PA 5..573 6..574 1543 50.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 19:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Mal-A1-PA 577 GE23004-PA 1..577 1..577 3031 96.9 Plus
Dyak\Mal-A3-PA 574 GE22993-PA 23..574 22..577 1553 50.8 Plus
Dyak\Mal-A4-PA 579 GE19202-PA 20..573 18..574 1538 51.3 Plus
Dyak\Mal-A8-PA 587 GE19205-PA 29..544 19..535 1533 53.8 Plus
Dyak\Mal-A7-PA 599 GE22983-PA 37..578 21..562 1528 52.1 Plus