Clone RE74560 Report

Search the DGRC for RE74560

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:745
Well:60
Vector:pFlc-1
Associated Gene/TranscriptCG4854-RA
Protein status:RE74560.pep: gold
Preliminary Size:960
Sequenced Size:1238

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4854 2001-12-17 Blastp of sequenced clone
CG4854 2002-01-01 Sim4 clustering to Release 2
CG4854 2003-01-01 Sim4 clustering to Release 3
CG4854 2008-04-29 Release 5.5 accounting
CG4854 2008-08-15 Release 5.9 accounting
CG4854 2008-12-18 5.12 accounting

Clone Sequence Records

RE74560.complete Sequence

1238 bp (1238 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071660

> RE74560.complete
GGTTGCCATTCGCCCCGGAGCCGCACAAATTTTAATTGTTTGGTCAGTAA
ACAAACAAAAATTAAATATTTCGGAATTTGTACCTACAATAACAGAAGAA
TGCATACCAACGTGGATAGCAGGGACCTTAAGTGTCGCATCTGCTTGGTG
CAGCCTAAGGATGAGTCTCTCATGCCCACGGAGCCCGATTTTCCAGATAA
AATCAAACGCTGCACAGGAGTTGAATTGAGTGAGAGTCCCGACTGGCCCA
ATCGCATCTGCACCAGCTGCGCCCTGCTGCTCAGAGCTGCCCTCAAACTC
AGATCCCTTTGCCAGCAGACGGAGAAGGATCTGAAGGAGCAGAAGCTGCA
GGAGATAAACATAGAGATTGTTCACGATGAGCAGGAGACGAAGAAGAAAA
CTGAATCAAGAGACCTGTCCAAGAATGAGGCTACCGGTAGCGACAGCGAG
TTGGAGTACGAGTACCTAGACTCATACGATGTAACGCTGGAGAGCAGCGA
GGATGTGGCCTGTAGTGCCGATGAATTGGTCAGCATAGAGCCTGCCATCT
CCGCTCCAGAGGAATCTGTCTATTCACTTAGTCCCAAACCGGTAACTTTT
GAAGACGAGGACTCCGGACAGGCTGCTTCCTTTACCTGCAACATTTGCAA
CAATGTCTACTCAGAGCGCGTAAAGTTGACCAACCACATGAAAGTCCACA
GCGCGAAGAAACCACACGAATGCGAAATCTGTCACAAACGTTTTCGCCAG
ACTCCGCAGTTGGCGAGGCACATGAACACCCACACCGGTAATCGTCCCTA
CAAATGTGACTATTGCGACTCCAGGTTCGCCGATCCCTCCACTCGCATTA
AGCATCAGAGGATCCACACCAACGAACGACCGTACAAATGCGAGTTCTGC
AGCAGGTCCTTTGGCTACTCCAACGTCCTCCGGGTTCATCTGAAAACCCA
TACCGGTGAACGACCATTTAGCTGCCAGTACTGCCAGAAGTCCTTCTCCC
AGCTGCACCACAAAAACAGCCACGAAAAGTCACACAAAAGGACGAAAGAG
GTAAAATGATTGCAGTGACTAAGAGGAAACATTGAGGTGCAAATTAAATA
AGTTTCTCGTTGAAAATTGTACAATATATTAATGGATAAGTTCTAAGCCA
TAGGGCACCGCCATTAAAATTTGTCATTTTTCCTTATTTAATTTTTTATA
AGAAGTAAAAAACAAATTGTACAAAAAAAAAAAAAAAA

RE74560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-RA 1253 CG4854-RA 27..1253 3..1229 6120 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 04:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15852273..15852772 226..725 2410 98.8 Plus
chr3R 27901430 chr3R 15853130..15853493 859..1222 1775 99.2 Plus
chr3R 27901430 chr3R 15851992..15852214 3..225 1115 100 Plus
chr3R 27901430 chr3R 15852838..15852973 726..861 650 98.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-RA 960 CG4854-PA 1..960 100..1059 4785 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:16:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-RA 1220 CG4854-RA 1..1220 3..1222 6085 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 04:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-PA 319 CG4854-PA 1..319 100..1056 1627 100 Plus
trem-PA 439 CG4413-PA 173..408 376..1041 471 41.2 Plus
CG4936-PA 521 CG4936-PA 360..496 631..1041 460 56.2 Plus
CG14711-PA 377 CG14711-PA 210..365 583..1044 419 44.9 Plus
CG4424-PA 345 CG4424-PA 11..326 133..1050 414 32.7 Plus
CG14711-PA 377 CG14711-PA 198..336 580..1047 245 35.3 Plus
CG4936-PA 521 CG4936-PA 362..470 721..1047 217 31.2 Plus
trem-PA 439 CG4413-PA 233..354 709..1047 178 26.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 04:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20028339..20028838 226..725 2500 100 Plus
3R 32079331 3R 20029198..20029568 859..1229 1840 99.7 Plus
3R 32079331 3R 20028058..20028280 3..225 1115 100 Plus
3R 32079331 3R 20028904..20029039 726..861 680 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19769170..19769669 226..725 2500 100 Plus
3R 31820162 3R 19770029..19770399 859..1229 1840 99.7 Plus
3R 31820162 3R 19768889..19769111 3..225 1115 100 Plus
3R 31820162 3R 19769735..19769870 726..861 680 100 Plus
3R 31820162 3R 19774176..19774245 747..816 170 82.8 Plus
Blast to na_te.dros performed on 2014-11-27 04:44:26 has no hits.

RE74560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:21:02 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15853132..15853493 861..1222 99   Plus
chr3R 15852838..15852972 726..860 98 -> Plus
chr3R 15852273..15852772 226..725 98 -> Plus
chr3R 15851990..15852214 1..225 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:37:22 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..960 100..1059 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:56 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..960 100..1059 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:41:39 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..960 100..1059 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:41 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..960 100..1059 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:21:02 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..960 100..1059 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:24:16 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..1222 2..1222 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:56 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..1222 2..1222 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:41:39 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..1222 2..1222 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:41 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..1222 2..1222 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:21:02 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..1220 3..1222 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:21:02 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20029200..20029561 861..1222 99   Plus
3R 20028904..20029038 726..860 100 -> Plus
3R 20028339..20028838 226..725 100 -> Plus
3R 20028056..20028280 1..225 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:41:39 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15854922..15855283 861..1222 99   Plus
arm_3R 15854626..15854760 726..860 100 -> Plus
arm_3R 15854061..15854560 226..725 100 -> Plus
arm_3R 15853778..15854002 1..225 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:46 Download gff for RE74560.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19770031..19770392 861..1222 99   Plus
3R 19769735..19769869 726..860 100 -> Plus
3R 19769170..19769669 226..725 100 -> Plus
3R 19768887..19769111 1..225 99 -> Plus

RE74560.hyp Sequence

Translation from 0 to 1058

> RE74560.hyp
DCHSPRSRTNFNCLVSKQTKIKYFGICTYNNRRMHTNVDSRDLKCRICLV
QPKDESLMPTEPDFPDKIKRCTGVELSESPDWPNRICTSCALLLRAALKL
RSLCQQTEKDLKEQKLQEINIEIVHDEQETKKKTESRDLSKNEATGSDSE
LEYEYLDSYDVTLESSEDVACSADELVSIEPAISAPEESVYSLSPKPVTF
EDEDSGQAASFTCNICNNVYSERVKLTNHMKVHSAKKPHECEICHKRFRQ
TPQLARHMNTHTGNRPYKCDYCDSRFADPSTRIKHQRIHTNERPYKCEFC
SRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFSQLHHKNSHEKSHKRTKE
VK*

RE74560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-PA 319 CG4854-PA 1..319 34..352 1720 100 Plus
trem-PA 439 CG4413-PA 173..408 126..347 471 41.2 Plus
CG4424-PA 345 CG4424-PA 11..326 45..350 460 32.7 Plus
CG4936-PA 521 CG4936-PA 360..496 211..347 460 56.2 Plus
CG14711-PA 377 CG14711-PA 7..365 45..348 455 30.9 Plus
trem-PA 439 CG4413-PA 1..354 34..349 218 21.1 Plus

RE74560.pep Sequence

Translation from 99 to 1058

> RE74560.pep
MHTNVDSRDLKCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWP
NRICTSCALLLRAALKLRSLCQQTEKDLKEQKLQEINIEIVHDEQETKKK
TESRDLSKNEATGSDSELEYEYLDSYDVTLESSEDVACSADELVSIEPAI
SAPEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVH
SAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRI
KHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFS
QLHHKNSHEKSHKRTKEVK*

RE74560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17633-PA 299 GF17633-PA 1..299 1..313 861 57.9 Plus
Dana\GF17340-PA 324 GF17340-PA 11..304 12..313 454 32.7 Plus
Dana\GF17634-PA 504 GF17634-PA 345..481 178..314 445 56.2 Plus
Dana\GF17339-PA 421 GF17339-PA 1..395 1..314 433 30.4 Plus
Dana\GF18382-PA 383 GF18382-PA 217..358 165..308 397 49.3 Plus
Dana\GF17339-PA 421 GF17339-PA 315..400 178..263 153 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23680-PA 323 GG23680-PA 1..320 1..319 1511 91.6 Plus
Dere\GG23691-PA 521 GG23691-PA 321..496 136..314 447 45.3 Plus
Dere\GG15653-PA 441 GG15653-PA 276..414 176..314 446 54 Plus
Dere\GG15664-PA 340 GG15664-PA 11..317 12..313 426 35 Plus
Dere\GG18277-PA 381 GG18277-PA 5..356 10..308 418 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17266-PA 311 GH17266-PA 1..305 5..319 836 55 Plus
Dgri\GH23243-PA 338 GH23243-PA 14..308 12..313 458 34.5 Plus
Dgri\GH17279-PA 474 GH17279-PA 270..449 132..314 456 45.9 Plus
Dgri\GH18111-PA 383 GH18111-PA 5..369 10..319 441 31.5 Plus
Dgri\GH23235-PA 468 GH23235-PA 301..439 176..314 434 51.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-PA 319 CG4854-PA 1..319 1..319 1720 100 Plus
trem-PA 439 CG4413-PA 173..408 93..314 471 41.2 Plus
CG4424-PA 345 CG4424-PA 11..326 12..317 460 32.7 Plus
CG4936-PA 521 CG4936-PA 360..496 178..314 460 56.2 Plus
CG14711-PA 377 CG14711-PA 7..365 12..315 455 30.9 Plus
trem-PA 439 CG4413-PA 1..354 1..316 218 21.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22441-PA 314 GI22441-PA 1..304 5..318 842 54.8 Plus
Dmoj\GI10316-PA 299 GI10316-PA 18..274 33..313 450 32.3 Plus
Dmoj\GI22443-PA 453 GI22443-PA 292..428 178..314 450 56.9 Plus
Dmoj\GI24612-PA 380 GI24612-PA 5..366 10..319 443 31.5 Plus
Dmoj\GI10315-PA 458 GI10315-PA 288..426 176..314 440 51.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12084-PA 333 GL12084-PA 8..317 12..313 771 50 Plus
Dper\GL12085-PA 505 GL12085-PA 345..481 178..314 444 54.7 Plus
Dper\GL12519-PA 457 GL12519-PA 290..428 176..314 440 52.5 Plus
Dper\GL12521-PA 328 GL12521-PA 11..305 12..313 433 32 Plus
Dper\GL22112-PA 374 GL22112-PA 5..349 10..308 421 31.8 Plus
Dper\GL12519-PA 457 GL12519-PA 292..374 234..316 163 32.5 Plus
Dper\GL12519-PA 457 GL12519-PA 348..433 178..263 152 30.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18481-PA 333 GA18481-PA 8..317 12..313 799 51.2 Plus
Dpse\GA18538-PA 505 GA18538-PA 345..481 178..314 444 54.7 Plus
Dpse\GA18168-PA 457 GA18168-PA 290..428 176..314 440 52.5 Plus
Dpse\GA18174-PA 329 GA18174-PA 41..306 33..313 432 33.8 Plus
Dpse\GA13193-PA 374 GA13193-PA 5..349 10..308 429 32.1 Plus
Dpse\GA18168-PA 457 GA18168-PA 348..433 178..263 152 30.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17690-PA 323 GM17690-PA 1..320 1..319 1550 95 Plus
Dsec\GM17691-PA 426 GM17691-PA 265..401 178..314 442 56.2 Plus
Dsec\GM17698-PA 434 GM17698-PA 270..408 176..314 440 53.2 Plus
Dsec\GM17699-PA 342 GM17699-PA 41..319 33..313 427 34.9 Plus
Dsec\GM23958-PA 377 GM23958-PA 223..356 175..308 393 49.3 Plus
Dsec\GM17698-PA 434 GM17698-PA 272..354 234..316 162 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19333-PA 323 GD19333-PA 1..320 1..319 1551 94.1 Plus
Dsim\GD19334-PA 519 GD19334-PA 358..494 178..314 446 56.2 Plus
Dsim\GD20084-PA 411 GD20084-PA 205..384 127..314 410 45.5 Plus
Dsim\GD18768-PA 377 GD18768-PA 223..356 175..308 394 49.3 Plus
Dsim\GD18767-PA 415 GD18767-PA 262..392 178..308 366 45.8 Plus
Dsim\GD18768-PA 377 GD18768-PA 5..332 10..312 258 24.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11004-PA 312 GJ11004-PA 1..302 5..318 841 55.4 Plus
Dvir\GJ11005-PA 479 GJ11005-PA 318..458 178..318 449 56 Plus
Dvir\GJ10170-PA 332 GJ10170-PA 14..308 12..317 447 33.4 Plus
Dvir\GJ22562-PA 378 GJ22562-PA 5..364 10..319 434 30.7 Plus
Dvir\GJ10169-PA 460 GJ10169-PA 290..428 176..314 432 51.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22369-PA 303 GK22369-PA 3..293 9..312 761 50.2 Plus
Dwil\GK22370-PA 450 GK22370-PA 287..423 178..314 443 56.2 Plus
Dwil\GK22796-PA 447 GK22796-PA 283..421 176..314 433 52.5 Plus
Dwil\GK22797-PA 346 GK22797-PA 43..317 33..308 426 32.7 Plus
Dwil\GK22769-PA 370 GK22769-PA 6..350 10..308 412 30.1 Plus
Dwil\GK22796-PA 447 GK22796-PA 287..395 208..316 188 31.2 Plus
Dwil\GK22796-PA 447 GK22796-PA 285..367 234..316 160 32.5 Plus
Dwil\GK22369-PA 303 GK22369-PA 159..244 234..319 157 31.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25642-PA 323 GE25642-PA 1..320 1..319 1522 89.4 Plus
Dyak\GE25643-PA 338 GE25643-PA 21..335 10..319 1380 84.1 Plus
Dyak\GE25091-PA 441 GE25091-PA 276..414 176..314 447 54 Plus
Dyak\GE25644-PA 521 GE25644-PA 317..496 132..314 447 44.3 Plus
Dyak\GE25094-PA 441 GE25094-PA 276..414 176..314 446 54 Plus