Clone RH03424 Report

Search the DGRC for RH03424

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:34
Well:24
Vector:pFlc-1
Associated Gene/TranscriptZasp52-RE
Protein status:RH03424.pep: gold
Preliminary Size:1224
Sequenced Size:3188

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30084 2002-10-13 Blastp of sequenced clone
CG30084 2008-04-29 Release 5.5 accounting
CG30084 2008-08-15 Release 5.9 accounting
Zasp 2008-12-18 5.12 accounting

Clone Sequence Records

RH03424.complete Sequence

3188 bp (3188 high quality bases) assembled on 2002-10-13

GenBank Submission: BT001752

> RH03424.complete
GAGTTGAGAGAAAATCGTCGCTTAGTTAACGTCGCCCAAGAACTGAACTG
GCAGTGCACCACAAACGTCACGAATATACGAAACCGAGATCCAAGTCCAA
ATCAGTAAAAATCAAATCAAATCGAAACCGTATCGAATCGAATCTAATCG
AATCCCAGCAGAAAGCCACCCGATCGGAATAAATCGTCAGCTCTAAAAGA
AGATGGCCCAACCACAGCTGCTGCAAATCAAATTGTCACGTTTCGATGCC
CAACCCTGGGGATTCCGCCTTCAGGGGGGCACGGACTTCGCTCAGCCCCT
GCTGGTGCAAAAGGTGAACGCCGGCAGCTTGTCCGAGCAGGCTGGCCTCC
AGCCCGGCGATGCGGTGGTCAAGATCAATGACGTGGATGTCTTCAATCTG
CGTCACAAGGATGCCCAGGACATTGTGGTGCGCTCCGGCAACAACTTTGT
CATCACAGTGCAGCGCGGTGGCTCCACCTGGCGCCCGCATGTGACACCGA
CTGGCAATGTGCCGCAGCCCAACTCGCCGTATCTGCAGACGGTGACGAAG
ACCTCTCTGGCTCACAAACAACAGGACAGCCAGCACATCGGCTGTGGCTA
CAACAACGCGGCCCGTCCCTTCTCCAACGGCGGCGATGGCGGCGTGAAGA
GCATTGTCAATAAACAATACAACACCCCGGTTGGCATTTACAGCGATGAA
TCTATTGCGGAAACACTCTCGGCCCAGGCGGAGGTTTTGGCTGGCGGTGT
GCTCGGCGTCAACTTCAAGAAGAACGAGAAGGAATACCAGGGCGATCGCT
CCGAGGTTCTGAAGTTCCTGCGCGAGGAGGAGACCGGCCAGTCCACTCCA
GAACCACACAGTCCCGCCAACTTCTACTGGACACAGAGCCACGCAATCGG
CGGCAACGAGCGACGCACTCCACTGCACCACCAGCACCAGCAGCCTCAGC
AGGATGAGCGGATTGGTGTACCATTGCAGTCAAATACACTGGCGCCGGAG
GCGACACACAGGCCCAGCTTGCCGGTGGCCCCGAAGGATAACGAGGAGCA
GGCCAGACAGGATCAGCAGGAGCAGCCCGATCCGCGCATCATTGTGCTGC
CCATCTGCCCCGGCCTCCAGGGGCCCGAGTATAAGGCTGAAATGGAGGCT
GCAGCCGCGGCACTGGCCACCGACCAGGATGGACGACCACGTCCATTGGC
CGCCAGCGGACATCCGGCCTGCCAGCTGTGCGGCGTGGGCATTGTTGGCG
TTTTCGTGCGCATCAAGGATAAGAACCTGCACGTGGAGTGCTTCAAGTGT
GCCACGTGTGGCACCTCGCTGAAGAACCAGGGCTACTACAACTTCAACAA
CAAGCTCTACTGCGACATCCACGCCAAACAGGCCGCCATCAACAATCCCC
CCACCGGCACCGAGGGCTACGTCCCCGTTCCCATCAAGCCCAACACCAAG
CTGAGTGCCTCCACCATCTCATCGGCCTTGAACTCGCACGGATACGGTGG
CCACTCGAACGGCTACTCCAATGGAAACTCCACCCCTGCTCCGGCACCGG
TGAACCAGGGCTATGCTCGTCCGTTCGGTGCCGCCGCTCCCAAGTCGCCG
GTGTCGTATCCGCCGCAGCAGCAACAGCAGTCGCCGCGTCCCGCTCCCGG
TGGCCAAAACCCGTACGCCACCCTGCCCCGCAGCAATGTGGGCCAACAAG
GTCGTAATGTAAGGTACCAACAACAGCAACAACAGCAGCAGCAATACAAC
AATCAGCAGAAGCAGCAGTATAGGAACTCTTACCCCATGGGATCTAATTA
TAGCACCCCGAGTCAGTCCCCCTACATCACCTCCAACACCAACAACTATA
GCAGCAGCAACAGCTACAATAACAACAACTATAGCAACTACAACAATAAT
AATGTGTACCGAGGTGCCGGAGGAAAGAGCGCTGGCGCCTTTGGAGCCAC
CTCGGCGCCCAAGAGGGGCAGGGGTATCCTGAATAAGGCAGCCGGACCCG
GAGTGCGCATCCCACTGTGCAACAGCTGCAATGTGCAGATCAGAGGACCC
TTTATCACGGCATTGGGCCGCATCTGGTGCCCGGATCATTTCATCTGCGT
GAACGGCAACTGCCGTCGTCCGCTGCAGGACATTGGATTCGTTGAGGAGA
AGGGCGATCTGTACTGCGAGTACTGTTTCGAGAAGTACCTGGCGCCCACT
TGCAGCAAGTGCGCTGGCAAGATCAAGGGTGACTGTTTGAATGCCATTGG
CAAACACTTCCATCCGGAGTGCTTCACCTGCGGCCAGTGCGGCAAGATCT
TTGGCAACAGGCCCTTCTTCCTGGAGGATGGAAACGCGTACTGCGAGGCC
GATTGGAACGAGTTGTTCACCACCAAGTGCTTCGCCTGCGGCTTCCCCGT
GGAAGCTGGCGACAGATGGGTGGAGGCCTTGAACCACAACTACCATAGCC
AATGCTTCAACTGCACGTTCTGCAAACAGAACCTGGAGGGTCAGAGCTTC
TACAACAAGGGCGGACGTCCCTTCTGCAAGAATCACGCGCGCTAAGCCGC
AACTCAGATGATTTTGTTCGACTTCAGGGATCACGCACAGTTGGTTAAAC
ACCAACTATCTATCAGAATCTTCGGATTACTTGGATACGGGAGCTTGCTC
CCAACTCGTATCTAATGCTTATTATTGCAATTGTCAGAGTGAATAATGCG
TAACTATTATTATTTCTATTTGTTTTTGAATTGTGCACACAAATGTTATC
CTAATTTTAACTGATGCGATCATCATCGATTCGCTCAAAATCAAAACAGT
AGCTGCAAACGAAACGAAATCGAATTAGCTAGCAAATTATATGTCCCACA
CAACTATTATTTATTCAAACATCGTATCATAACCGAACTACCGAACCCCA
GATAACTATGTATGTACTGTGGCCAGAGTTAATTTACTTAGTTGAGCCTG
AAAACTGTTGATCAACCCGTAACCAAAAGCTAACAAATCGCGCGAGAGGA
TTTCCCAAAACCGATTGGCGGCCTAGAATCGGGCTAATCAGAGATGTCAA
ACGAGGTTGTCAGCAGGCAGTTGCTTACTTAATTTCTAAATTTATGTTGT
AAATTATCCATAATTCGATTGTAAATTGTAAATGATCAGCAAGTGAATAA
ATTTCGAAATCTTTTTCGCGTCTAAAAAAAAAAAAAAA

RH03424.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-RE 3209 Zasp52-RE 33..3209 2..3178 15870 99.9 Plus
Zasp52-RC 3950 Zasp52-RC 2319..3950 1549..3180 8145 99.9 Plus
Zasp52-RG 3538 Zasp52-RG 1910..3538 1549..3177 8130 99.9 Plus
Zasp52-RG 3538 Zasp52-RG 33..1582 2..1551 7750 100 Plus
Zasp52-RC 3950 Zasp52-RC 51..715 187..851 3325 100 Plus
Zasp52-RC 3950 Zasp52-RC 936..1239 1246..1549 1520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11649813..11650517 3171..2467 3525 100 Minus
chr2R 21145070 chr2R 11666491..11666887 1245..849 1970 99.7 Minus
chr2R 21145070 chr2R 11650596..11650837 2467..2226 1210 100 Minus
chr2R 21145070 chr2R 11660265..11660481 1915..1699 1085 100 Minus
chr2R 21145070 chr2R 11665578..11665772 1440..1246 975 100 Minus
chr2R 21145070 chr2R 11650891..11651078 2228..2041 940 100 Minus
chr2R 21145070 chr2R 11701983..11702167 186..2 925 100 Minus
chr2R 21145070 chr2R 11670316..11670473 622..465 775 99.4 Minus
chr2R 21145070 chr2R 11670543..11670696 465..312 755 99.4 Minus
chr2R 21145070 chr2R 11661040..11661193 1702..1549 740 98.7 Minus
chr2R 21145070 chr2R 11669001..11669134 756..623 670 100 Minus
chr2R 21145070 chr2R 11652369..11652500 2043..1912 660 100 Minus
chr2R 21145070 chr2R 11690588..11690717 315..186 650 100 Minus
chr2R 21145070 chr2R 11664402..11664512 1551..1441 525 98.2 Minus
chr2R 21145070 chr2R 11668213..11668308 851..756 450 97.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-RE 2343 CG30084-PE 1..2343 203..2545 11715 100 Plus
Zasp52-RN 3804 CG30084-PN 1..1711 203..1913 8555 100 Plus
Zasp52-RO 1548 CG30084-PO 1..1500 203..1702 7500 100 Plus
Zasp52-RN 3804 CG30084-PN 3171..3804 1912..2545 3170 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:18:35 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-RE 3176 CG30084-RE 5..3174 2..3171 15850 100 Plus
Zasp52-RR 3002 CG37-RR 1075..3000 1246..3171 9630 100 Plus
Zasp52-RN 4637 CG37-RN 5..1916 2..1913 9560 100 Plus
Zasp52-RR 3002 CG37-RR 5..854 2..851 4250 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-PE 780 CG30084-PE 1..780 203..2542 3475 100 Plus
Zasp52-PR 722 CG30084-PR 1..722 203..2542 2845 84.8 Plus
Zasp52-PN 1267 CG30084-PN 1..542 203..1828 2358 100 Plus
Zasp52-PO 515 CG30084-PO 1..497 203..1693 2286 100 Plus
Zasp52-PG 890 CG30084-PG 1..455 203..1567 2161 99.1 Plus
Zasp52-PN 1267 CG30084-PN 1073..1267 1958..2542 1141 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15762558..15763271 3180..2467 3555 99.9 Minus
2R 25286936 2R 15779265..15779661 1245..849 1985 100 Minus
2R 25286936 2R 15763350..15763591 2467..2226 1210 100 Minus
2R 25286936 2R 15773039..15773255 1915..1699 1085 100 Minus
2R 25286936 2R 15778352..15778546 1440..1246 975 100 Minus
2R 25286936 2R 15763645..15763832 2228..2041 940 100 Minus
2R 25286936 2R 15814729..15814913 186..2 925 100 Minus
2R 25286936 2R 15783088..15783245 622..465 790 100 Minus
2R 25286936 2R 15773814..15773967 1702..1549 770 100 Minus
2R 25286936 2R 15783315..15783468 465..312 770 100 Minus
2R 25286936 2R 15781773..15781906 756..623 670 100 Minus
2R 25286936 2R 15765123..15765254 2043..1912 660 100 Minus
2R 25286936 2R 15803359..15803488 315..186 650 100 Minus
2R 25286936 2R 15777176..15777286 1551..1441 555 100 Minus
2R 25286936 2R 15780985..15781080 851..756 480 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15763757..15764470 3180..2467 3555 99.8 Minus
2R 25260384 2R 15780464..15780860 1245..849 1985 100 Minus
2R 25260384 2R 15764549..15764790 2467..2226 1210 100 Minus
2R 25260384 2R 15774238..15774454 1915..1699 1085 100 Minus
2R 25260384 2R 15779551..15779745 1440..1246 975 100 Minus
2R 25260384 2R 15764844..15765031 2228..2041 940 100 Minus
2R 25260384 2R 15815928..15816112 186..2 925 100 Minus
2R 25260384 2R 15784287..15784444 622..465 790 100 Minus
2R 25260384 2R 15784514..15784667 465..312 770 100 Minus
2R 25260384 2R 15775013..15775166 1702..1549 770 100 Minus
2R 25260384 2R 15782972..15783105 756..623 670 100 Minus
2R 25260384 2R 15766322..15766453 2043..1912 660 100 Minus
2R 25260384 2R 15804558..15804687 315..186 650 100 Minus
2R 25260384 2R 15778375..15778485 1551..1441 555 100 Minus
2R 25260384 2R 15782184..15782279 851..756 480 100 Minus
Blast to na_te.dros performed 2014-11-27 10:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5204..5254 2734..2685 117 72.5 Minus

RH03424.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:40:05 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11690590..11690716 187..313 100 <- Minus
chr2R 11670543..11670694 314..465 99 <- Minus
chr2R 11670316..11670472 466..622 99 <- Minus
chr2R 11669001..11669134 623..756 100 <- Minus
chr2R 11668213..11668307 757..851 97 <- Minus
chr2R 11666491..11666884 852..1245 99 <- Minus
chr2R 11665578..11665772 1246..1440 100 <- Minus
chr2R 11664404..11664512 1441..1549 98 <- Minus
chr2R 11661042..11661192 1550..1700 98 <- Minus
chr2R 11660463..11660479 1701..1717 100 <- Minus
chr2R 11660347..11660409 1771..1833 100 == Minus
chr2R 11652369..11652500 1912..2043 100 == Minus
chr2R 11650892..11651075 2044..2227 100 <- Minus
chr2R 11650596..11650835 2228..2467 100 <- Minus
chr2R 11649811..11650516 2468..3173 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:04:26 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp-RE 1..2343 203..2545 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:11:05 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 1..2343 203..2545 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:08:31 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 1..2343 203..2545 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:01:56 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG30084-RE 1..2343 203..2545 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:40:05 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 1..2343 203..2545 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:04:25 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp-RE 1..3171 2..3173 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:11:05 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 32..3203 1..3173 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:08:31 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 4..3175 1..3173 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:01:56 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG30084-RE 1..3171 2..3173 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:40:05 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
Zasp52-RE 4..3175 1..3173 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:40:05 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15814729..15814913 1..186 99   Minus
2R 15803361..15803487 187..313 100 <- Minus
2R 15783315..15783466 314..465 100 <- Minus
2R 15783088..15783244 466..622 100 <- Minus
2R 15781773..15781906 623..756 100 <- Minus
2R 15780985..15781079 757..851 100 <- Minus
2R 15779265..15779658 852..1245 100 <- Minus
2R 15778352..15778546 1246..1440 100 <- Minus
2R 15777178..15777286 1441..1549 100 <- Minus
2R 15773816..15773966 1550..1700 100 <- Minus
2R 15773041..15773253 1701..1913 100 <- Minus
2R 15765123..15765252 1914..2043 100 <- Minus
2R 15763646..15763829 2044..2227 100 <- Minus
2R 15763350..15763589 2228..2467 100 <- Minus
2R 15762565..15763270 2468..3173 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:08:31 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11702234..11702418 1..186 99   Minus
arm_2R 11690866..11690992 187..313 100 <- Minus
arm_2R 11670820..11670971 314..465 100 <- Minus
arm_2R 11670593..11670749 466..622 100 <- Minus
arm_2R 11669278..11669411 623..756 100 <- Minus
arm_2R 11668490..11668584 757..851 100 <- Minus
arm_2R 11666770..11667163 852..1245 100 <- Minus
arm_2R 11665857..11666051 1246..1440 100 <- Minus
arm_2R 11664683..11664791 1441..1549 100 <- Minus
arm_2R 11661321..11661471 1550..1700 100 <- Minus
arm_2R 11660546..11660758 1701..1913 100 <- Minus
arm_2R 11652628..11652757 1914..2043 100 <- Minus
arm_2R 11651151..11651334 2044..2227 100 <- Minus
arm_2R 11650855..11651094 2228..2467 100 <- Minus
arm_2R 11650070..11650775 2468..3173 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:33:36 Download gff for RH03424.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15815928..15816112 1..186 99   Minus
2R 15804560..15804686 187..313 100 <- Minus
2R 15784514..15784665 314..465 100 <- Minus
2R 15784287..15784443 466..622 100 <- Minus
2R 15782972..15783105 623..756 100 <- Minus
2R 15782184..15782278 757..851 100 <- Minus
2R 15780464..15780857 852..1245 100 <- Minus
2R 15779551..15779745 1246..1440 100 <- Minus
2R 15778377..15778485 1441..1549 100 <- Minus
2R 15775015..15775165 1550..1700 100 <- Minus
2R 15774240..15774452 1701..1913 100 <- Minus
2R 15766322..15766451 1914..2043 100 <- Minus
2R 15764845..15765028 2044..2227 100 <- Minus
2R 15764549..15764788 2228..2467 100 <- Minus
2R 15763764..15764469 2468..3173 99 <- Minus

RH03424.pep Sequence

Translation from 202 to 2544

> RH03424.pep
MAQPQLLQIKLSRFDAQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQ
PGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQRGGSTWRPHVTPT
GNVPQPNSPYLQTVTKTSLAHKQQDSQHIGCGYNNAARPFSNGGDGGVKS
IVNKQYNTPVGIYSDESIAETLSAQAEVLAGGVLGVNFKKNEKEYQGDRS
EVLKFLREEETGQSTPEPHSPANFYWTQSHAIGGNERRTPLHHQHQQPQQ
DERIGVPLQSNTLAPEATHRPSLPVAPKDNEEQARQDQQEQPDPRIIVLP
ICPGLQGPEYKAEMEAAAAALATDQDGRPRPLAASGHPACQLCGVGIVGV
FVRIKDKNLHVECFKCATCGTSLKNQGYYNFNNKLYCDIHAKQAAINNPP
TGTEGYVPVPIKPNTKLSASTISSALNSHGYGGHSNGYSNGNSTPAPAPV
NQGYARPFGAAAPKSPVSYPPQQQQQSPRPAPGGQNPYATLPRSNVGQQG
RNVRYQQQQQQQQQYNNQQKQQYRNSYPMGSNYSTPSQSPYITSNTNNYS
SSNSYNNNNYSNYNNNNVYRGAGGKSAGAFGATSAPKRGRGILNKAAGPG
VRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK
GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIF
GNRPFFLEDGNAYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQ
CFNCTFCKQNLEGQSFYNKGGRPFCKNHAR*

RH03424.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-27 18:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13372-PA 883 GF13372-PA 1..438 1..443 2096 93 Plus
Dana\GF13372-PA 883 GF13372-PA 555..883 450..780 1448 89.3 Plus
Dana\GF15196-PA 620 GF15196-PA 364..529 606..775 341 39.4 Plus
Dana\GF15150-PA 178 GF15150-PA 6..173 605..775 306 34.9 Plus
Dana\GF22290-PA 178 GF22290-PA 6..173 605..775 286 33.7 Plus
Dana\GF19820-PA 152 GF19820-PA 3..150 603..754 230 29.6 Plus
Dana\GF15196-PA 620 GF15196-PA 364..472 667..777 227 37.8 Plus
Dana\GF15196-PA 620 GF15196-PA 421..611 604..775 222 27.2 Plus
Dana\GF15196-PA 620 GF15196-PA 480..619 604..722 187 31.4 Plus
Dana\GF22290-PA 178 GF22290-PA 7..115 667..776 174 32.4 Plus
Dana\GF15150-PA 178 GF15150-PA 7..115 667..776 170 33.3 Plus
Dana\GF15150-PA 178 GF15150-PA 66..175 606..716 155 31.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-27 18:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22334-PA 1940 GG22334-PA 1..216 1..216 1136 99.5 Plus
Dere\GG22334-PA 1940 GG22334-PA 297..530 220..449 1053 93.6 Plus
Dere\GG22334-PA 1940 GG22334-PA 1763..1940 604..780 1018 96.1 Plus
Dere\GG21635-PA 584 GG21635-PA 351..519 606..778 346 38.7 Plus
Dere\GG21514-PA 178 GG21514-PA 6..173 605..775 295 34.9 Plus
Dere\GG22334-PA 1940 GG22334-PA 709..794 450..543 282 81.1 Plus
Dere\GG18228-PA 200 GG18228-PA 26..197 603..777 271 33.5 Plus
Dere\GG21635-PA 584 GG21635-PA 408..575 604..775 250 30.2 Plus
Dere\GG22918-PA 175 GG22918-PA 5..171 605..775 244 29.2 Plus
Dere\GG22334-PA 1940 GG22334-PA 1432..1496 559..623 219 69.2 Plus
Dere\GG21635-PA 584 GG21635-PA 467..583 604..722 205 35.3 Plus
Dere\GG21514-PA 178 GG21514-PA 7..115 667..776 172 33.3 Plus
Dere\GG18228-PA 200 GG18228-PA 21..137 659..776 167 31.1 Plus
Dere\GG21514-PA 178 GG21514-PA 66..175 606..716 149 29.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-27 18:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20594-PA 1166 GH20594-PA 1..452 1..443 1949 84.9 Plus
Dgri\GH20594-PA 1166 GH20594-PA 969..1166 583..780 1147 99 Plus
Dgri\GH13469-PA 585 GH13469-PA 352..520 606..778 349 38.7 Plus
Dgri\GH10298-PA 189 GH10298-PA 18..184 606..775 280 31.6 Plus
Dgri\GH12803-PA 179 GH12803-PA 7..174 605..775 277 32.6 Plus
Dgri\GH13469-PA 585 GH13469-PA 409..576 604..775 252 30.2 Plus
Dgri\GH17840-PA 736 GH17840-PA 523..707 605..776 228 29.9 Plus
Dgri\GH13469-PA 585 GH13469-PA 468..584 604..722 210 36.1 Plus
Dgri\GH12803-PA 179 GH12803-PA 8..116 667..776 193 32.4 Plus
Dgri\GH10298-PA 189 GH10298-PA 18..126 667..776 185 35.1 Plus
Dgri\GH20594-PA 1166 GH20594-PA 562..663 450..532 176 61.9 Plus
Dgri\GH10298-PA 189 GH10298-PA 77..186 606..716 174 31.5 Plus
Dgri\GH12803-PA 179 GH12803-PA 67..176 606..716 155 31.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 18:39:10
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-PE 780 CG30084-PE 1..780 1..780 4271 100 Plus
Zasp52-PG 890 CG30084-PG 1..890 1..780 3623 79.4 Plus
Zasp52-PR 722 CG30084-PR 1..722 1..780 3538 85.5 Plus
Zasp52-PS 787 CG30084-PS 1..787 1..780 3309 76.7 Plus
Zasp52-PU 716 CG30084-PU 1..716 1..780 3101 76.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-27 18:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19738-PA 1709 GI19738-PA 1..458 1..449 1948 85.9 Plus
Dmoj\GI19738-PA 1709 GI19738-PA 1512..1709 583..780 1155 99.5 Plus
Dmoj\GI17221-PA 605 GI17221-PA 372..540 606..778 345 38.7 Plus
Dmoj\GI17994-PA 183 GI17994-PA 11..178 605..775 323 35.5 Plus
Dmoj\GI15958-PA 179 GI15958-PA 7..174 605..775 250 32.6 Plus
Dmoj\GI17221-PA 605 GI17221-PA 429..596 604..775 249 30.2 Plus
Dmoj\GI21753-PA 710 GI21753-PA 497..681 605..776 228 29.9 Plus
Dmoj\GI17221-PA 605 GI17221-PA 488..604 604..722 208 36.1 Plus
Dmoj\GI17994-PA 183 GI17994-PA 5..120 660..776 187 34.7 Plus
Dmoj\GI15958-PA 179 GI15958-PA 8..116 667..776 166 33.3 Plus
Dmoj\GI19738-PA 1709 GI19738-PA 715..781 441..504 157 67.6 Plus
Dmoj\GI17994-PA 183 GI17994-PA 71..180 606..716 154 29.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-27 18:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11852-PA 455 GL11852-PA 1..446 1..451 2088 89.4 Plus
Dper\GL11853-PA 271 GL11853-PA 23..271 524..780 1130 86 Plus
Dper\GL21108-PA 639 GL21108-PA 388..554 606..776 344 39.2 Plus
Dper\GL25856-PA 177 GL25856-PA 6..173 605..775 286 36 Plus
Dper\GL11647-PA 185 GL11647-PA 5..171 605..775 270 31.6 Plus
Dper\GL21108-PA 639 GL21108-PA 388..496 667..777 229 37.8 Plus
Dper\GL21108-PA 639 GL21108-PA 445..630 604..775 229 27.9 Plus
Dper\GL21108-PA 639 GL21108-PA 504..638 604..722 192 32.6 Plus
Dper\GL25856-PA 177 GL25856-PA 6..115 666..776 164 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-27 18:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15635-PC 786 GA15635-PC 1..786 1..780 3441 85.7 Plus
Dpse\GA15635-PB 873 GA15635-PB 1..445 1..450 2076 89.6 Plus
Dpse\GA15635-PF 742 GA15635-PF 285..742 329..780 1851 80.9 Plus
Dpse\GA15635-PG 714 GA15635-PG 285..714 329..780 1724 74.9 Plus
Dpse\GA15635-PH 511 GA15635-PH 1..500 1..501 1670 69.7 Plus
Dpse\GA15635-PB 873 GA15635-PB 539..873 450..780 1360 81.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-27 18:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20121-PA 1961 GM20121-PA 1..216 1..216 1128 99.1 Plus
Dsec\GM20121-PA 1961 GM20121-PA 293..524 220..474 1104 87.1 Plus
Dsec\GM20121-PA 1961 GM20121-PA 1784..1961 604..780 1016 95.5 Plus
Dsec\GM17013-PA 581 GM17013-PA 348..516 606..778 347 38.7 Plus
Dsec\GM22049-PA 178 GM22049-PA 6..173 605..775 293 34.3 Plus
Dsec\GM23266-PA 178 GM23266-PA 6..173 605..775 293 34.3 Plus
Dsec\GM20121-PA 1961 GM20121-PA 702..824 450..574 284 89.6 Plus
Dsec\GM13370-PA 209 GM13370-PA 37..205 605..776 279 32.4 Plus
Dsec\GM17013-PA 581 GM17013-PA 405..572 604..775 250 30.2 Plus
Dsec\GM20121-PA 1961 GM20121-PA 1438..1488 571..621 226 86.3 Plus
Dsec\GM17013-PA 581 GM17013-PA 464..580 604..722 205 35.3 Plus
Dsec\GM22049-PA 178 GM22049-PA 7..115 667..776 173 32.4 Plus
Dsec\GM23266-PA 178 GM23266-PA 7..115 667..776 173 32.4 Plus
Dsec\GM22049-PA 178 GM22049-PA 66..175 606..716 155 30.6 Plus
Dsec\GM23266-PA 178 GM23266-PA 66..175 606..716 155 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-27 18:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25597-PA 1571 GD25597-PA 1..447 1..449 2289 98.7 Plus
Dsim\GD25597-PA 1571 GD25597-PA 1362..1571 571..780 1222 100 Plus
Dsim\GD21763-PA 678 GD21763-PA 348..513 606..775 343 39.4 Plus
Dsim\GD17716-PA 178 GD17716-PA 6..173 605..775 293 34.3 Plus
Dsim\GD21644-PA 178 GD21644-PA 6..173 605..775 293 34.3 Plus
Dsim\GD25597-PA 1571 GD25597-PA 629..751 450..574 283 89.6 Plus
Dsim\GD15732-PA 209 GD15732-PA 37..205 605..776 253 32.4 Plus
Dsim\GD21763-PA 678 GD21763-PA 348..456 667..777 229 37.8 Plus
Dsim\GD21763-PA 678 GD21763-PA 405..513 604..714 175 31.5 Plus
Dsim\GD17716-PA 178 GD17716-PA 7..115 667..776 173 32.4 Plus
Dsim\GD21644-PA 178 GD21644-PA 7..115 667..776 173 32.4 Plus
Dsim\GD17716-PA 178 GD17716-PA 66..175 606..716 155 30.6 Plus
Dsim\GD21644-PA 178 GD21644-PA 66..175 606..716 155 30.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-27 18:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18448-PA 1587 GJ18448-PA 1..454 1..449 1938 86.2 Plus
Dvir\GJ18448-PA 1587 GJ18448-PA 1299..1587 515..780 1194 76.2 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 364..532 606..778 346 38.7 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 9..176 605..775 325 35.5 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 421..588 604..775 250 30.2 Plus
Dvir\GJ19131-PA 695 GJ19131-PA 482..666 605..776 228 29.9 Plus
Dvir\GJ15157-PA 1421 GJ15157-PA 708..884 606..775 213 28.5 Plus
Dvir\GJ17978-PA 597 GJ17978-PA 480..596 604..722 209 36.1 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 10..118 667..776 188 35.1 Plus
Dvir\GJ19592-PA 181 GJ19592-PA 69..178 606..716 160 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-27 18:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19612-PA 1126 GK19612-PA 1..457 1..451 1952 87.2 Plus
Dwil\GK19612-PA 1126 GK19612-PA 794..1126 450..780 1318 81.5 Plus
Dwil\GK23838-PA 630 GK23838-PA 374..539 606..775 342 39.4 Plus
Dwil\GK21109-PA 236 GK21109-PA 6..174 605..775 305 34.9 Plus
Dwil\GK15192-PA 177 GK15192-PA 6..173 605..775 278 33.1 Plus
Dwil\GK25502-PA 195 GK25502-PA 23..190 605..775 271 33.1 Plus
Dwil\GK23838-PA 630 GK23838-PA 374..482 667..777 223 37.8 Plus
Dwil\GK23838-PA 630 GK23838-PA 431..621 604..775 222 27.2 Plus
Dwil\GK23838-PA 630 GK23838-PA 490..629 604..722 191 32.1 Plus
Dwil\GK15192-PA 177 GK15192-PA 65..175 605..716 172 33 Plus
Dwil\GK21109-PA 236 GK21109-PA 7..115 667..776 170 32.4 Plus
Dwil\GK15192-PA 177 GK15192-PA 7..115 667..776 165 33.3 Plus
Dwil\GK21109-PA 236 GK21109-PA 66..176 606..716 153 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-27 18:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14134-PA 1937 GE14134-PA 1..216 1..216 1131 99.1 Plus
Dyak\GE14134-PA 1937 GE14134-PA 297..523 220..449 1116 96.1 Plus
Dyak\GE14134-PA 1937 GE14134-PA 1760..1937 604..780 1016 96.1 Plus
Dyak\GE12653-PA 581 GE12653-PA 348..516 606..778 347 38.7 Plus
Dyak\GE12993-PA 178 GE12993-PA 6..173 605..775 294 34.9 Plus
Dyak\GE15647-PA 179 GE15647-PA 5..174 603..775 266 33.9 Plus
Dyak\GE12653-PA 581 GE12653-PA 405..572 604..775 250 30.2 Plus
Dyak\GE14134-PA 1937 GE14134-PA 703..789 450..542 238 86 Plus
Dyak\GE14355-PA 187 GE14355-PA 5..171 605..775 233 28.7 Plus
Dyak\GE14134-PA 1937 GE14134-PA 1441..1493 571..623 225 84.9 Plus
Dyak\GE12653-PA 581 GE12653-PA 464..580 604..722 205 35.3 Plus
Dyak\GE12993-PA 178 GE12993-PA 7..115 667..776 172 33.3 Plus
Dyak\GE15647-PA 179 GE15647-PA 8..117 667..777 151 31.2 Plus
Dyak\GE12993-PA 178 GE12993-PA 66..175 606..716 149 29.7 Plus
Dyak\GE15647-PA 179 GE15647-PA 67..176 606..716 148 33.3 Plus

RH03424.hyp Sequence

Translation from 202 to 2544

> RH03424.hyp
MAQPQLLQIKLSRFDAQPWGFRLQGGTDFAQPLLVQKVNAGSLSEQAGLQ
PGDAVVKINDVDVFNLRHKDAQDIVVRSGNNFVITVQRGGSTWRPHVTPT
GNVPQPNSPYLQTVTKTSLAHKQQDSQHIGCGYNNAARPFSNGGDGGVKS
IVNKQYNTPVGIYSDESIAETLSAQAEVLAGGVLGVNFKKNEKEYQGDRS
EVLKFLREEETGQSTPEPHSPANFYWTQSHAIGGNERRTPLHHQHQQPQQ
DERIGVPLQSNTLAPEATHRPSLPVAPKDNEEQARQDQQEQPDPRIIVLP
ICPGLQGPEYKAEMEAAAAALATDQDGRPRPLAASGHPACQLCGVGIVGV
FVRIKDKNLHVECFKCATCGTSLKNQGYYNFNNKLYCDIHAKQAAINNPP
TGTEGYVPVPIKPNTKLSASTISSALNSHGYGGHSNGYSNGNSTPAPAPV
NQGYARPFGAAAPKSPVSYPPQQQQQSPRPAPGGQNPYATLPRSNVGQQG
RNVRYQQQQQQQQQYNNQQKQQYRNSYPMGSNYSTPSQSPYITSNTNNYS
SSNSYNNNNYSNYNNNNVYRGAGGKSAGAFGATSAPKRGRGILNKAAGPG
VRIPLCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEK
GDLYCEYCFEKYLAPTCSKCAGKIKGDCLNAIGKHFHPECFTCGQCGKIF
GNRPFFLEDGNAYCEADWNELFTTKCFACGFPVEAGDRWVEALNHNYHSQ
CFNCTFCKQNLEGQSFYNKGGRPFCKNHAR*

RH03424.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Zasp52-PE 780 CG30084-PE 1..780 1..780 4271 100 Plus
Zasp52-PG 890 CG30084-PG 1..890 1..780 3623 79.4 Plus
Zasp52-PR 722 CG30084-PR 1..722 1..780 3538 85.5 Plus
Zasp52-PS 787 CG30084-PS 1..787 1..780 3309 76.7 Plus
Zasp52-PU 716 CG30084-PU 1..716 1..780 3101 76.5 Plus